(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4996

AL939122.SCO4996     Location/Qualifiers
FT   CDS_pept        complement(65560..66069)
FT                   /transl_table=11
FT                   /gene="SCO4996"
FT                   /gene_synonym="2SCK36.19c"
FT                   /product="putative RNA polymerase ECF sigma factor"
FT                   /note="2SCK36.19c, probable RNA polymerase ECF sigma
FT                   factor, len: 169 aa; similar to SW:RPOE_STRCO (EMBL:L29636)
FT                   Streptomyces coelicolor RNA polymerase sigma-E factor SigE
FT                   or SCE94.07, 176 aa; fasta scores: opt: 278 Z-score: 347.2
FT                   bits: 70.7 E(): 9.9e-12; 36.527% identity in 167 aa
FT                   overlap. Contains Pfam match to entry PF00776 Sigma70_ECF,
FT                   Sigma-70 factor (ECF subfamily)"
FT                   /db_xref="GOA:Q93JJ8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JJ8"
FT                   /protein_id="CAC40609.1"
FT                   /translation="MRQGRADEYAEFAVARAGHLYRSACLLTAGDTHLAEDLVQETFGR
FT                   LYVRWGRVSRAENPAAYAQTVLTRAFLAHQRRRSSGERATDVFPDLPGAGDGDASLRLT
FT                   LLDALARLPAKDRAVVVLRYWDDRSVEQTADVLGVSSAAVRTRCSRALGRLRELLGEDL
FT                   SEYARP"
     atgaggcagg ggcgggcgga cgagtacgcc gagttcgcgg tggcgcgggc cgggcatctg        60
     taccggtccg cgtgtctgct caccgccggg gacacgcatc tggccgagga tctcgtgcag       120
     gagaccttcg ggcggctcta cgtgcggtgg gggcgggtgt cgcgggcgga gaacccggcc       180
     gcctacgcgc agaccgtgct cacccgcgcc ttcctcgccc atcagcggcg gcgcagcagc       240
     ggggagcggg cgaccgacgt gttccccgat ctgcccggcg ccggtgacgg ggacgcgtcc       300
     ctgcggctga cgctgctgga cgcgctcgcg cggctgcccg ccaaggaccg ggccgtggtc       360
     gtcctgcggt actgggacga ccgctcggtc gagcagaccg ccgacgtgct cggcgtcagt       420
     tcggcggcgg tgcggacccg gtgctcgcgg gcgctcggcc ggctgcggga gctgctgggc       480
     gaggacctct cggagtacgc cagaccctag                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page