(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4997

AL939122.SCO4997     Location/Qualifiers
FT   CDS_pept        complement(66168..66359)
FT                   /transl_table=11
FT                   /gene="SCO4997"
FT                   /gene_synonym="2SCK36.20c"
FT                   /product="hypothetical protein"
FT                   /note="2SCK36.20c, hypothetical protein, len: 63 aa;
FT                   similar to TR:Q9F3E1 (EMBL:AL450289) Streptomyces
FT                   coelicolor putative AbaA-like protein SC2H2.14, 89 aa;
FT                   fasta scores: opt: 96 Z-score: 150.9 bits: 31.9 E(): 0.86;
FT                   32.787% identity in 61 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JJ7"
FT                   /protein_id="CAC40610.1"
FT                   /translation="MDDITWEEPFCGEGASCFRLGTDATGNAYVAIAGAEDAALTDSRE
FT                   ALRRMILDIKAGKADHLL"
     atggatgaca tcacgtggga agaaccgttc tgcggggagg gagcgagctg cttccgcctc        60
     ggcaccgacg ccactggcaa cgcctacgtg gccatagccg gtgcggagga cgccgccctc       120
     accgacagcc gggaggcgct gcggcggatg atcctcgaca tcaaggcggg gaaggccgac       180
     cacctgctgt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page