(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4998

AL939122.SCO4998     Location/Qualifiers
FT   CDS_pept        complement(66371..67222)
FT                   /transl_table=11
FT                   /gene="SCO4998"
FT                   /gene_synonym="2SCK36.21c"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK36.21c, hypothetical protein, len: 283 aa;
FT                   similar to TR:Q9XD96 (EMBL:AF106004) Streptomyces
FT                   coelicolor hypothetical 31.8 kDa protein ORF3, 283 aa;
FT                   fasta scores: opt: 815 Z-score: 959.3 bits: 185.4 E():
FT                   8e-46; 45.230% identity in 283 aa overlap. Contains Pfam
FT                   match to entry PF01381 HTH_3, Helix-turn-helix"
FT                   /db_xref="GOA:Q93JJ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JJ6"
FT                   /protein_id="CAC40611.1"
FT                   /translation="MPPRTTPTERQRRLGAELRKMRTAAGITADQAAGLLGLDRAKVSN
FT                   IETGIRTISPERLRTLACNCDCSDEAYVEALVRMARPGARGWWERYRGSLSAGLLDIAE
FT                   FEAQATRMRTIHIAHIPGLLQTSDHALELFRAVLPLLPEHEVALRLAYRVERQRVLEGD
FT                   DPPEYVAVVHEAAVRMQFGGPTVARAQLEHLVAVSERPTVRLLVVPFTAGAFPGSGQIF
FT                   NYLEGPVPQLDTVQIDSTHGPEFLSGEAQLAKYRTHLDRMERIALSPQASRDFIRDVAN
FT                   GL"
     atgcctccga ggacgacacc gaccgagcgt cagaggcgat tgggcgccga actgcggaag        60
     atgcggaccg cggcgggcat aacggccgac caggccgccg ggctgctcgg gctggaccgg       120
     gcgaaggtct ccaacatcga gaccggcatc cgcaccatca gccctgagcg gctgcgcact       180
     ctcgcctgca actgcgactg ttccgacgag gcgtacgtcg aggcgctggt ccgcatggcc       240
     cggcctggcg cgcgcgggtg gtgggagcgt taccggggtt cgctgtccgc ggggctgctc       300
     gacatcgccg agttcgaggc gcaggcaacg cgcatgcgca ctatccacat cgcgcacatc       360
     ccgggactgc tgcaaaccag cgaccacgcc ctcgaactct tccgggcagt cctgccgctg       420
     ctgccggagc acgaggtcgc gctacggctg gcgtaccgcg tcgagcggca gcgggtactc       480
     gaaggcgacg acccgccaga gtacgtcgcc gttgtccacg aggctgccgt gcggatgcag       540
     ttcggtggcc ccactgtcgc tcgggcgcag ttggagcatc tggtcgcggt ctcggagcgg       600
     ccgaccgtac ggctgctggt cgtgcccttc accgccgggg ccttcccggg ttccgggcag       660
     atcttcaact acctggaggg accggtgcct cagttggaca ccgtccagat cgacagcacg       720
     cacgggccgg aattcctcag cggcgaggcc caactcgcga agtaccgtac gcacctggac       780
     cggatggagc gcatcgccct gtctccgcag gcatcccgcg acttcatccg ggacgtcgcc       840
     aacggcctgt ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page