(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4999

AL939122.SCO4999     Location/Qualifiers
FT   CDS_pept        67435..67923
FT                   /transl_table=11
FT                   /gene="SCO4999"
FT                   /gene_synonym="SCK15.01"
FT                   /product="hypothetical protein SCK15.01"
FT                   /note="SCK15.01, hypothetical protein, len: 162 aa; similar
FT                   to TR:CAB7697 (EMBL:AL159178) Streptomyces coelicolor
FT                   hypothetical 16.8 kD protein SCH22A.02c, 160 aa; fasta
FT                   scores: opt: 133 z-score: 165.9 E(): 0.09; 28.9% identity
FT                   in 142 aa overlap"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KYA3"
FT                   /protein_id="CAB92592.1"
FT                   /translation="MPTTRCPAAPTYPADPTPPIPETLAYSLTLPAALASAALARATTR
FT                   EVLRAHGLTDMLDPALQAVGELTAVASQFTESSNYYLTLRYRFSTLRLIAYDSHPRHTS
FT                   PHLATACDTRRRAALRVLACVCRACDGTWGFGEAREPGGGTRMWATLPRASAAAYGAS"
     atgcccacaa cccgttgccc cgccgccccc acctacccgg ctgacccgac gccccccatc        60
     cctgaaaccc tggcctacag cctcacgctc cccgccgcac tggccagcgc agcgctcgca       120
     cgggcgacga ccagggaggt cctgcgcgcg cacggcctga cggacatgct ggaccccgcg       180
     ctgcaggcgg taggcgaatt gacggccgtc gcaagccaat tcacggagtc ctcgaactac       240
     tacctgaccc tccgctaccg cttctccacc ctccgcctga tcgcctacga cagtcacccc       300
     cgacacacca gccctcactt ggccaccgcc tgcgacaccc gacgtcgcgc ggccctccgc       360
     gtcctggcct gcgtctgccg cgcatgcgac ggcacttggg gcttcggcga ggcgagggaa       420
     ccgggtggcg gcacacgcat gtgggcgacc ctgccgaggg cgagcgcggc ggcgtacggg       480
     gcgtcttga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page