(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5001

AL939122.SCO5001     Location/Qualifiers
FT   CDS_pept        68611..69252
FT                   /transl_table=11
FT                   /gene="SCO5001"
FT                   /gene_synonym="SCK15.03"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.03, possible integral membrane protein, len:
FT                   213 aa; similar to TR:CAB77310 (EMBL:AL160312) Streptomyces
FT                   coelicolor putative integral membrane protein SCD35.26, 198
FT                   aa; fasta scores: opt: 349 z-score: 424.5 E(): 3.6e-16;
FT                   37.4% identity in 182 aa overlap. Contains possible
FT                   hydrophobic membrane spanning regions at C-terminal domain"
FT                   /db_xref="GOA:Q9KYA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KYA1"
FT                   /protein_id="CAB92594.1"
FT                   /translation="MSLRRHLGKLLRATGEDGRPSGSAHAPGSSGETVASFTTEVPWPS
FT                   LRKFAQFAYIAEQYGYRYSGLDPDLRDSGTPFFVFRRLPDAGERAARTRGSFPGAPENG
FT                   RLPGMRAWPLPVLTLPAARSEVKLLLARIVVDYYGALGRQRMRPWLIGIPVVFLLFLLV
FT                   NGELHATGLRVAAGMAVALIVVLTASRVFMRRRRATYRRLLERSGLGPPP"
     gtgagccttc ggcgccacct cgggaagctc ctgcgcgcga cgggagagga cggtcggccc        60
     agtgggtccg ctcacgcacc cggctcgtcc ggtgaaaccg tggcgtcctt cacgacagag       120
     gtcccgtggc cgtcgctgcg gaagttcgct cagttcgcgt acatcgccga gcagtacgga       180
     taccggtact ccggcctgga tccggacctg cgggactccg gcacgccgtt cttcgtcttc       240
     cggcgcctgc cggacgcggg cgaacgcgcc gctcgcacga gggggagttt ccccggcgct       300
     cccgagaacg gccgactgcc gggaatgcgc gcatggccgc tacccgtgct gacgctgccg       360
     gcggcacgga gcgaggtgaa gctgctgctc gcccggatcg tcgtcgacta ctacggtgcg       420
     ttgggacggc agcggatgcg tccgtggctc atcggcattc cggtggtgtt cctgctcttt       480
     ctgctggtga atggcgagct gcacgcgaca ggactgcgcg tcgcggccgg tatggccgtg       540
     gcgttgatcg tggtgctgac ggcttccagg gtcttcatgc gccgtcgccg tgcgacgtac       600
     cggcggctgc ttgagcggtc ggggctcggc ccgcctccgt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page