(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5007

AL939122.SCO5007     Location/Qualifiers
FT   CDS_pept        75085..75480
FT                   /transl_table=11
FT                   /gene="SCO5007"
FT                   /gene_synonym="minD2"
FT                   /gene_synonym="SCK15.09"
FT                   /product="putative septum site-determining protein"
FT                   /note="SCK15.09, minD2, possible septum site-determining
FT                   protein, len: 131 aa; similar to C-terminal domain of
FT                   TR:Q9ZF15 (EMBL:AJ005576) Streptomyces griseus septum
FT                   site-determining protein MinD protein, 396 aa; fasta
FT                   scores: opt: 360 z-score: 444.6 E(): 2.7e-17; 47.3%
FT                   identity in 129 aa overlap and to Streptomyces coelicolor
FT                   septum site-determining protein minD3 SCK15.10, 131 aa;
FT                   fasta scores: opt: 177 z-score: 196.8 E(): 2.1e-05; 35.8%
FT                   identity in 109 aa overlap. Contains possible hydrophobic
FT                   membrane spanning region and TTA leucine codon, possible
FT                   target for bldA regulation"
FT                   /db_xref="GOA:Q9KY95"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY95"
FT                   /protein_id="CAB92600.1"
FT                   /translation="MSGLRGRDRARDGGQVTIEFLGMTPVIIATLVVLWQLVLVGYTYT
FT                   LAGNAADEAVRAATAAERGARQGACREAGLDKLPGSWEGGASVGCDAAGGFVTADVRIE
FT                   VPLLFPGTLSLPFTVHGHAGAVEEEDD"
     gtgagcgggt tacgcgggcg ggaccgcgcc cgggacggcg gtcaggtcac catcgagttc        60
     ctcggcatga cgccggtgat catcgcgacg ctggtggtgc tgtggcagct cgtgctcgtg       120
     ggatacacgt acacgctcgc ggggaatgct gcggacgagg cggtacgggc ggcgacggcg       180
     gccgagcgag gggcgcggca gggggcctgc cgggaggcgg gcctggacaa gctgccaggc       240
     tcgtgggagg gaggtgccag tgtcggctgc gacgccgcgg gcggtttcgt caccgccgac       300
     gtgcgcatcg aggtccccct cctcttcccg ggcaccctca gcctcccgtt caccgtgcac       360
     ggccacgcgg gggccgtgga agaggaggac gactga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page