(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5009

AL939122.SCO5009     Location/Qualifiers
FT   CDS_pept        75896..77233
FT                   /transl_table=11
FT                   /gene="SCO5009"
FT                   /gene_synonym="SCK15.11"
FT                   /product="putative secretory protein"
FT                   /note="SCK15.11, probable secretory protein, len: 445 aa;
FT                   similar to TR:P94647 (EMBL:U77780) Chlorobium limicola
FT                   secretory protein kinase Kbh, 474 aa; fasta scores: opt:
FT                   1192 z-score: 1311.8 E(): 0; 47.7% identity in 396 aa
FT                   overlap, to SW:TRBB_AGRT6 (EMBL:U43675) Agrobacterium
FT                   tumefaciens conjugal transfer protein TrbB, 323 aa; fasta
FT                   scores: opt: 512 z-score: 568.9 E(): 3.2e-24; 30.4%
FT                   identity in 326 aa overlap and to TR:Q9X921 (EMBL:AL035636)
FT                   Streptomyces coelicolor putative secretory protein
FT                   SCH5.19c, 523 aa; fasta scores: opt: 878 z-score: 847.4
FT                   E(): 0; 40.3% identity in 365 aa overlap. Contains Pfam
FT                   match to entry PF00437 GSPII_E, Bacterial type II secretion
FT                   system protein and match to Prosite entry PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9KY93"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY93"
FT                   /protein_id="CAB92602.1"
FT                   /translation="MSLRARIHSPEEHGSRGEDGHLVASYRAKLLEEIDLAEMSALATA
FT                   ERRARLERVLGHIISREGPVLSTVERSQLIRRVVDEALGLGILEPLLEDASITEIMVNG
FT                   PDAIFVERAGRVEQLPLRFASHDQLMQTIERIVSTVNRRVDESNPMVDARLPSGERVNV
FT                   IIPPLSLTGATLTIRRFPRSFTLQELIGLGSLDENMLYLLAGLVQARFNIIVSGATGTG
FT                   KTTLLNALSGLIPESDRIITIEDSAELQLQQAHVIRLESRPPNVEGQGRITIRDLVRNS
FT                   LRMRPDRIVVGEVRGGESLDMLQAMSTGHDGSLATVHANSAEDALMRLQTLASMSDVEI
FT                   PFVALHDQINSSVDVLIQLTRFADGARRITEIALLASHGGEPYRLATVARFNARPMSAD
FT                   GRVVGAYEYHPLPHRTAERLYMAGQPIPQAFGVAHTPDQLTTREAR"
     atgagcctgc gcgcacgcat ccactccccc gaggagcacg gcagccgggg cgaggacgga        60
     cacctggtcg cctcctaccg ggccaaactc ctggaggaga tcgacctcgc cgagatgagc       120
     gcgctcgcga cggccgagcg ccgggcccgc ctggagcggg tcctcgggca catcatcagc       180
     cgcgagggcc cggtcctgtc gacggtcgag cgctcccagc tgatccgccg ggtcgtcgac       240
     gaggccctcg gcctgggcat cctggaaccg ctcctcgaag acgcgtcgat cacggagatc       300
     atggtcaacg gcccggacgc gatcttcgtc gaacgcgccg gccgcgtcga acagctcccc       360
     ctccgcttcg cctcccacga ccagctgatg cagaccatcg agcgcatcgt ctcgacggtc       420
     aaccgccgcg tggacgagtc gaacccgatg gtcgacgccc gcctcccctc cggcgagcgc       480
     gtcaacgtca tcatcccgcc gctctccctc accggcgcca ccctcaccat ccgccgcttc       540
     ccccgctcct tcaccctcca ggagctgatc ggcctgggct cgctcgacga gaacatgctc       600
     tacctgctgg caggcctcgt gcaggcccgc ttcaacatca tcgtctcggg cgcgacgggc       660
     accgggaaga ccaccctcct caacgccctc tccggcctca tccccgaatc cgaccgcatc       720
     atcaccatcg aggactcggc cgaactccag ctccagcagg cgcacgtcat ccgcctggag       780
     tcgcgtccgc ccaacgtcga gggccagggc cgcatcacca tccgcgacct ggtccgcaac       840
     tcgctgcgca tgcgccccga ccgcatcgtc gtcggcgagg tgcgcggcgg tgagtccctg       900
     gacatgctcc aggccatgtc caccggccac gacggctcgc tggccaccgt ccacgccaac       960
     agcgcggagg acgccctgat gcgcctgcag accctggcct cgatgtccga cgtggagatc      1020
     cccttcgtcg ccctgcacga ccagatcaac agctccgtcg acgtcctgat ccagctcacc      1080
     cgcttcgccg acggcgcccg ccgcatcacc gagatcgccc tgctggccag ccacggcggc      1140
     gagccctacc gcctggccac ggtcgcccgc ttcaacgccc gcccgatgtc cgccgacggc      1200
     cgcgtcgtcg gcgcgtacga gtaccacccg ctcccgcacc gcaccgccga acgcctctac      1260
     atggcgggcc agcccatccc gcaggccttc ggcgtggccc acacaccgga ccagctcacc      1320
     acccgagaag ccaggtag                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page