(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5010

AL939122.SCO5010     Location/Qualifiers
FT   CDS_pept        77243..78193
FT                   /transl_table=11
FT                   /gene="SCO5010"
FT                   /gene_synonym="SCK15.12"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.12, possible integral membrane protein, len:
FT                   316 aa; similar to TR:AAF40196 (EMBL:AF229646) Caulobacter
FT                   crescentus hypothetical 34.6 kD protein, 325 aa; fasta
FT                   scores: opt: 287 z-score: 328.2 E(): 8.2e-11; 21.9%
FT                   identity in 315 aa overlap. Contains possible N-terminal
FT                   region signal peptide sequence and possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9KY92"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY92"
FT                   /protein_id="CAB92603.1"
FT                   /translation="MEPELDTLVTLTTGVTLLTCVLAIVGLHSYAAGKAQRAALVDRLT
FT                   ATGQAPSAGRRRRFPTLDRRLRRTGLGRNLERRLSATGLDVTPGEFFAYMLATVAGLWL
FT                   IGQAALAPFFGPLAGLLGIGVAIQFLNWQRQKRIEKFINQLPELARILANATQAGLALR
FT                   TAIGMAAEELEAPAGEELGKVADQLAIGASMDDALGELAGRLPSRELVVLVTTLVLSNR
FT                   AGGQVVGALRNLTETLEERKETRREVRTQLSQVTMTSYAVPVLGIGSLLLMNGVKDGAL
FT                   ERMTGSPAGQAAVITAFALYAVGFVLIRRLSRIDV"
     atggaaccgg aactcgacac gctcgtcacg ctcaccaccg gcgtcacgct gctgacctgc        60
     gtcctggcga tcgtcggcct gcactcctac gccgccggca aggcccagcg cgcggccctg       120
     gtcgaccgcc tcaccgcgac cggccaggca ccgtcggccg gacgccgacg ccgcttcccg       180
     accctggacc gccgcctgcg ccgcaccggg ctgggccgga acctggaacg ccgcctgtcg       240
     gcgaccggcc tggacgtgac ccccggcgag ttcttcgcgt acatgctggc gacggtcgcc       300
     ggcctgtggc tgatcggcca ggcggccctg gcccccttct tcggccccct ggcgggcctc       360
     ctcggcatcg gcgtggcgat ccagttcctc aactggcaac gtcagaaacg catcgagaag       420
     ttcatcaacc aactccccga actcgcccgc attctcgcca acgccaccca ggccggactc       480
     gccctgcgca ccgccatcgg catggccgcg gaggaactgg aggccccggc cggcgaggaa       540
     ctcggcaagg tggccgacca actcgccatc ggcgcctcca tggacgacgc cctcggcgaa       600
     ctcgccggcc gcctcccctc ccgcgaactg gtggtcctgg tcaccaccct cgtgctgtcc       660
     aaccgcgccg gcggccaggt ggtcggcgcg ctgcgcaacc tgacggagac cctggaggaa       720
     cgcaaggaga cccggcgcga ggtccgcacc caactctccc aggtcacgat gacgtcgtat       780
     gccgtccccg tcctgggtat cggctcgttg ctcctgatga acggggtgaa ggacggcgcc       840
     ctggaacgca tgacgggctc cccggccggc caggccgccg tgatcaccgc cttcgcgctc       900
     tacgccgtcg gcttcgtcct catccgccgc ctgtcccgca tcgacgtctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page