(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5012

AL939122.SCO5012     Location/Qualifiers
FT   CDS_pept        79378..79575
FT                   /transl_table=11
FT                   /gene="SCO5012"
FT                   /gene_synonym="SCK15.14"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.14, possible integral membrane protein, len:
FT                   65 aa; similar to some other integral membrane proteins,
FT                   e.g. TR:AAF40189 (EMBL:AF229646) Caulobacter crescentus
FT                   PilA, 59 aa; fasta scores: opt: 84 z-score: 142.8 E(): 1.8;
FT                   36.2% identity in 47 aa overlap. Contains possible
FT                   hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q9KY90"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY90"
FT                   /protein_id="CAB92605.1"
FT                   /translation="MTNWLHTAAAYLHTRLTTRHDKGQTAVEYLGIIAVVVAIVLAITG
FT                   TDIGETIYNAITDKIDEVID"
     atgaccaact ggctccacac cgcagccgca tacctgcaca cccgcctcac cacccggcac        60
     gacaagggcc agacggcggt ggagtacctg ggcatcatcg ccgtggtggt ggcgatcgtc       120
     ctggcgatca cggggacgga catcggcgag acgatctaca acgcgatcac ggacaagatc       180
     gacgaggtca tcgactga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page