(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5014

AL939122.SCO5014     Location/Qualifiers
FT   CDS_pept        80207..80785
FT                   /transl_table=11
FT                   /gene="SCO5014"
FT                   /gene_synonym="SCK15.16"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.16, possible secreted protein, len: 192 aa.
FT                   Contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY88"
FT                   /protein_id="CAB92607.1"
FT                   /translation="MGIRFAVKVRNGATGLTVAVGLALCVVGCSSGGGDDNKAEASASA
FT                   TAGEQSDPTAQEGTDSPLAELKGEDGLLLTIDSAERDAGGFVTVSGEIKNDGAEAARVP
FT                   IQTRGDETEIMRHGGSLGGATLVDPAKKKRYYVLRDTDGRPLTTTDMPRIKPGASIPVF
FT                   MQFPAPPTDTGKVTFQLPTFASAPIEISG"
     atgggcatcc ggttcgccgt gaaggtccgc aacggagcga ccggcttgac tgtcgcggtc        60
     gggttggccc tctgcgtggt cggttgcagc agtgggggcg gtgacgacaa caaggctgag       120
     gcatcggcat ccgctacagc aggggagcag tcggatccca cggctcagga gggcaccgac       180
     tctcccctgg ccgaactcaa aggcgaggac ggcctactgc tgaccatcga ctccgccgaa       240
     cgcgacgcgg ggggtttcgt gacggtgagc ggcgagatca agaacgacgg tgctgaggcg       300
     gcgcgcgtcc cgattcagac caggggggac gagacggaga tcatgcgcca cggtggatca       360
     ctcggcggcg ccactcttgt ggacccggcg aagaagaagc gctattacgt gttgcgtgac       420
     accgacggcc gacccttgac gaccacagac atgcctcgga tcaagccggg agcgtccatt       480
     cccgtcttca tgcagtttcc ggcacccccg accgatacgg gcaaggtcac cttccaactc       540
     cccactttcg cctccgcgcc cattgagatc tcgggatga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page