(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5015

AL939122.SCO5015     Location/Qualifiers
FT   CDS_pept        80794..81405
FT                   /transl_table=11
FT                   /gene="SCO5015"
FT                   /gene_synonym="SCK15.17"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.17, possible secreted protein, len: 203 aa;
FT                   similar to many other membrane proteins, e.g. TR:Q9S6B8
FT                   (EMBL:AF115336) Pseudomonas fluorescens major outer
FT                   membrane protein OprF, 343 aa; fasta scores: opt: 247
FT                   z-score: 285.4 E(): 2e-08; 34.3% identity in 181 aa
FT                   overlap. Contains Pfam match to entry PF00691 OmpA, OmpA
FT                   family and possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="GOA:Q9KY87"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY87"
FT                   /protein_id="CAB92608.1"
FT                   /translation="MHNSRVAVLLTTSVLTAASVGVSQSYAADDPPGTEPSASAPVEVD
FT                   PNDPDLKLPDGATLAQAKVLDIKSVVEEQSGDERREDTNTSVTLALQAEVLFGKDSSKL
FT                   GAEAKSRIRGIADEIRTQNATRVRVFGFTDDLGSSAHGDVLSKRRANAVHDVLSQSLND
FT                   AGITYEVRGYGEQYPIADNSTEAGRKKNRRVEVSFPRTEP"
     atgcacaaca gccgcgtcgc agtgctcctc acgacgtccg tactgacggc cgcaagcgtt        60
     ggcgtgagcc agtcctacgc agctgacgac cccccgggca ccgaaccctc cgcctccgcc       120
     cccgtggagg tggaccccaa cgaccccgac ctgaagctcc cggacggggc cacgctcgcg       180
     caggcgaagg tgctggacat caagtcggtg gtggaagagc agagcggtga cgaacgccgc       240
     gaggacacca acaccagcgt gacgctcgcg ctccaggccg aggtgctgtt cggcaaggac       300
     agctcgaagc tcggcgcgga ggcgaagtcc cgcatcagag gcatcgccga cgagatcagg       360
     acccagaacg ccacacgagt ccgcgtcttc ggcttcaccg acgacctcgg ctcctccgcc       420
     cacggcgacg tactctccaa acgccgggcc aacgccgtac acgacgtcct gtcccagtcc       480
     ctcaacgacg ccggcatcac ctacgaggtc cgcggctacg gcgagcagta ccccatcgcc       540
     gacaactcga cggaagccgg ccgcaagaag aaccgcaggg tcgaggtctc cttcccccgc       600
     acggagccct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page