(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5016

AL939122.SCO5016     Location/Qualifiers
FT   CDS_pept        complement(81503..82318)
FT                   /transl_table=11
FT                   /gene="SCO5016"
FT                   /gene_synonym="SCK15.18c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.18c, possible secreted protein, len: 271 aa.
FT                   Contains possible N-terminal region signal peptide sequence
FT                   and a repeat region: 7x AS at N-terminal domain"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY86"
FT                   /protein_id="CAB92609.1"
FT                   /translation="MGEVAAVVSAITAVAGLLLAVFGIPLVGNSSPIGRSVADSGPTSG
FT                   AAPAASHSTADAGSEGASASASASASASASGSSKVPSSTAPSGSAPTGQPPAGGDEPRS
FT                   SASASSCSSSLPQGWRRVEVPALTVCFGRPGGWGEKPAGELQSSWGSPDGVYDLTVKRD
FT                   RTYGTTARAASAGQLAWYRDTSESSMAGVEVTTHKTRQNGRDALWLEIDYHWEKQSAPR
FT                   KRLEVFVAGKAGYVYQLLVDTEATSQRLAEQSRLFASARKNLLIDVSTG"
     atgggggagg tggcggccgt ggtctcggcg atcacggccg tcgcggggct cctcctggcg        60
     gtcttcggga tacctctcgt cgggaactcc tcgccgatcg ggcggagtgt ggcggactcc       120
     ggcccgactt ccggtgcagc cccggccgcg tcgcattcga ctgcggatgc gggttcggaa       180
     ggggcctcgg catcggcgtc ggcatccgcg tcggcttcgg cttctggttc ctcgaaggtg       240
     ccctcttcga ccgcgccttc gggctccgcg ccgactgggc aacctcctgc cggaggagac       300
     gagccccgct cctcggcgtc ggcgtcgtcc tgctcgtcgt ctcttcccca ggggtggcgg       360
     cgggtcgagg tccccgcgct gaccgtctgc ttcggtcggc cgggcggatg gggcgagaag       420
     cccgccggtg aactgcagag ctcctggggt tccccggacg gcgtgtacga cctgaccgtc       480
     aagcgggaca ggacgtacgg cacgaccgct cgggcggcct ccgccgggca gctggcctgg       540
     tatcgcgaca cctccgagtc gtcgatggcc ggcgtcgagg tcaccacgca caagacgcgc       600
     cagaacggtc gggacgctct ctggctggag atcgactacc actgggagaa gcagagcgca       660
     ccgcgcaaac gcctggaggt cttcgtcgcc gggaaggccg gctacgtgta ccagttgctg       720
     gtcgacaccg aggcgacatc gcagcggctg gccgagcaga gccgcctgtt cgcgtccgcg       780
     cggaagaacc tgctgatcga cgtcagcacg gggtga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page