(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5017

AL939122.SCO5017     Location/Qualifiers
FT   CDS_pept        82526..83623
FT                   /transl_table=11
FT                   /gene="SCO5017"
FT                   /gene_synonym="SCK15.19"
FT                   /product="putative araC family regulatory protein"
FT                   /note="SCK15.19, possible araC family regulatory protein,
FT                   len: 365 aa; similar to TR:Q54308 (EMBL:X86780)
FT                   Streptomyces hygroscopicus helix-turn-helix DNA-binding
FT                   protein, 330 aa; fasta scores: opt: 247 z-score: 294.6 E():
FT                   6.1e-09; 28.6% identity in 346 aa overlap. Contains fam
FT                   match to entry PF00165 HTH_AraC, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family and match to Prosite
FT                   entry PS00041 Bacterial regulatory proteins, araC family
FT                   signature. Contains also a TTA leucine codon, possible
FT                   target for bldA regulation"
FT                   /db_xref="GOA:Q9KY85"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY85"
FT                   /protein_id="CAB92610.1"
FT                   /translation="MPGDEQPRRGRRHTERGTAVEQTGTWDASVFLSTDSVSGPEGFGW
FT                   WGDMVSRAVMPVSIASEHAGHFKGEVTTLELVDTDFSAFSFSPMSARRTPDHIRASDPE
FT                   NYYLFLVHGSPIGLEQRRNNALLRAGDVALFDTSQPLACEFQDQGRPSRVSVLRLPRTA
FT                   LPLPGDRTDRLVATPLPARTGSGALLTSYLAGLRENAAHCGPTELRRLGTMALELAVTF
FT                   LAARLDSPPALPAESRRRVLLARINAYIDHNLHDPDLGPATIAAHHHISIRLLHALFEE
FT                   EPETVGATIRRRRLERSRTDLGDPRLRHRTIGEIAARWGFRHPAAFSRTFREAYGISPT
FT                   EARTALHDKQPCTPRRGPGHRTLAP"
     atgccgggag acgagcaacc gcggcggggg cggagacaca cggagcgggg gacagcggtg        60
     gagcagaccg gaacgtggga tgcctcggtg ttcctctcca cggacagcgt cagcggcccg       120
     gaggggttcg gctggtgggg cgacatggtc agccgggcgg tgatgccggt gtcgatcgcc       180
     agcgaacacg ccggccactt caagggcgag gtcaccacgc tggaactggt ggacaccgac       240
     ttctcggcct tctccttctc cccgatgtcg gcgcgccgga ccccggacca catccgggcg       300
     tccgacccgg agaactacta cctcttcctc gtccacggca gcccgatcgg tctggagcag       360
     cgtcgcaaca acgccctcct ccgggcggga gacgtggccc tcttcgacac ctcgcagcct       420
     ctggcctgcg agttccagga ccagggccgc ccctcgcggg tgagcgtgct gcggctgccc       480
     cggaccgccc tgccgctgcc cggcgacaga acggaccgtc tggtggccac gccgctgccc       540
     gcccgcaccg gttcgggcgc gctgctcacc tcctacctgg ccggactgcg ggagaacgcc       600
     gcgcactgcg gcccgacgga gctgcgccgc ctgggaacca tggccctcga actcgccgtc       660
     accttcctcg ccgcccgcct ggacagccct ccggcgttac cggccgagag ccgcaggcgg       720
     gtgctcctcg cccgtatcaa cgcctacatc gaccacaacc tgcacgatcc ggacctcggc       780
     ccggccacga tcgccgccca ccaccacatc tcgatacgcc tgctgcacgc cctcttcgag       840
     gaggagccgg aaacggtcgg cgccacgatc cgccgccgca gactcgaacg cagccggacc       900
     gacctcggcg acccccgcct acgacaccgc acgatcggcg agatcgccgc ccgatggggc       960
     ttccgccacc ccgccgcctt cagccgcacc ttccgcgagg cctacggcat ctccccgacc      1020
     gaagcccgaa ccgcactcca cgacaaacag ccctgcactc cccgccgagg accggggcat      1080
     cgaaccctgg caccttga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page