(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5019

AL939122.SCO5019     Location/Qualifiers
FT   CDS_pept        complement(83993..84598)
FT                   /transl_table=11
FT                   /gene="SCO5019"
FT                   /gene_synonym="SCK15.21c"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.21c, possible secreted protein, len: 201 aa;
FT                   similar to TR:Q9UZM5 (EMBL:AJ248286;) Pyrococcus abyssi
FT                   hypothetical 13.4 kD protein, 117 aa; fasta scores: opt:
FT                   167 z-score: 206.8 E(): 0.00048; 31.0% identity in 100 aa
FT                   overlap. Contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY83"
FT                   /protein_id="CAB92612.1"
FT                   /translation="MPISASATASFPLPGLSSLPHADSVKAAVAVSVSAVKRAGQRALT
FT                   IGSWVGRGFSSAKQFCTEGIGMGRQRWRDGAGALVVVGQSGEGACVPLEIAGSYRARTK
FT                   GLLGRGSVDGAMLLTPANSVHTFRMRMAIDVAYLDRRLNVIAVRTMRPGRLGLPRLRAR
FT                   HVLEAEAGAMDEWGVRVGARVEVVEGSAESADGAGRLG"
     gtgcccatat ccgcctcggc aaccgcgtcc ttccccttgc cggggctgtc gtcgctgccg        60
     cacgcggaca gcgtcaaggc cgccgtggcg gtcagcgtga gcgctgtgaa gagggcgggg       120
     caacgggcac tcactatcgg ctcctgggtg gggcggggct tctcgtcagc gaagcagttt       180
     tgcacggagg gcatcggaat gggacgacag cggtggcggg acggggcggg ggctctggtc       240
     gtggtggggc agagcggcga gggtgcgtgc gttccgctgg agatcgccgg ctcgtaccgc       300
     gcgcgtacca aggggctgtt ggggcgcggc tcggtcgatg gggcgatgct gctgacgccc       360
     gccaacagcg tgcacacgtt ccggatgcgg atggccatcg acgtggccta tctcgaccgg       420
     cggctcaacg tcatcgccgt gcgcacgatg cggccgggca ggctggggct gccccggttg       480
     cgggcgcggc acgtgctgga ggcggaggcc ggggcgatgg atgagtgggg ggtgcgggtg       540
     ggggcgcggg tggaggtcgt ggagggctcg gccgagtcgg cggacggcgc aggccggctg       600
     ggctag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page