(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5020

AL939122.SCO5020     Location/Qualifiers
FT   CDS_pept        84591..85127
FT                   /transl_table=11
FT                   /gene="SCO5020"
FT                   /gene_synonym="SCK15.22"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK15.22, hypothetical protein, len: 178 aa; similar
FT                   to C-terminal region of TR:Q9KY81 (EMBL:AL356813)
FT                   Streptomyces coelicolor putative lipoprotein SCK15.23, 221
FT                   aa; fasta scores: opt: 444 Z-score: 519.8 E(): 2.5e-21;
FT                   39.080% identity in 174 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY82"
FT                   /protein_id="CAB92613.1"
FT                   /translation="MGTTSPSASPTESESSKAGRPKIELPADLSYSFEWPKSGDQVKDA
FT                   ILADAEQSIKAVDLAIVNQDALDKAYLYYYEGEAAAGTQKFIQNYVDQKAGITGRYRFY
FT                   APEVAVDEDGTASFTYCEDQGRAYVKYLETNKVRRTEVSAQSYVIYHTSLKKNGEGVWE
FT                   IQKIDSQSGSAKCRP"
     atgggcacca cttccccgtc tgcctcgccg accgagtccg agtcgtcgaa ggccggtaga        60
     ccgaagatcg agctcccggc cgacctctcc tactcgttcg agtggccgaa gtcgggagac       120
     caggtcaagg acgcgatcct tgcggatgcc gagcagtcca tcaaggccgt ggacttggcg       180
     atcgtcaacc aggacgcact cgacaaggcc tatctctact actacgaggg cgaggctgcc       240
     gccggcacgc agaagttcat ccagaactat gtggatcaaa aggcgggtat cacgggacgc       300
     taccgcttct acgcccctga agtggcggtc gatgaagacg gcacggcgtc cttcacgtac       360
     tgcgaagacc aaggcagggc gtacgtgaag tacctcgaga ccaacaaggt gagaagaacc       420
     gaagtatccg cacagagcta cgtcatctac cacacttcac tgaagaagaa cggtgaaggt       480
     gtgtgggaga tccaaaagat cgactcgcag agtgggagcg ccaagtgccg gccctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page