(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5021

AL939122.SCO5021     Location/Qualifiers
FT   CDS_pept        85315..85980
FT                   /transl_table=11
FT                   /gene="SCO5021"
FT                   /gene_synonym="SCK15.23"
FT                   /product="putative lipoprotein"
FT                   /note="SCK15.23, possible lipoprotein, len: 221 aa; similar
FT                   to Streptomyces coelicolor SCK15.24, 220 aa; fasta scores:
FT                   opt: 736 z-score: 652.9 E(): 8.3e-31; 54.3% identity in 221
FT                   aa overlap. Contains correctly situated match to Prosite
FT                   entry PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site and possible N-terminal region signal
FT                   peptide sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY81"
FT                   /protein_id="CAB92614.1"
FT                   /translation="MNRRRPTLLAALTLTAAAALTLSACGSDGSPGKGEGEIAGSDVGD
FT                   ESSASPSPSSSSTAAAGRPKVKLPPDLRLTFEDAETGDPVKDAVLADNAERMRAVDAAI
FT                   SGTDPKGKALGFYNTGKALEAAVSWVGQFEKANATVTGHVRFFDRDVTLKGTTSAVLTF
FT                   CADESKGFSKDKETGEVTKTPVTKDSYVQYNTRLDKNADGVWQTSQILSTRGAAQCQA"
     gtgaatcgcc gccgacccac cctgctcgca gcgctcacgc tgaccgccgc agcggccttg        60
     acgctgtccg cgtgcggaag cgacggcagc ccgggcaagg gggagggcga gatcgcggga       120
     tcggacgtgg gggacgagtc gtctgcctcg ccgagcccct cctcctcgtc cactgcggca       180
     gccggccgac cgaaggtgaa gcttccgccg gacctgaggc tgaccttcga agacgcagag       240
     accggagacc cggtcaagga cgccgttctc gccgacaacg cagagcggat gcgtgccgtc       300
     gacgctgcca tcagcggtac ggaccctaag ggcaaggcgc ttggcttcta caacacgggc       360
     aaggccctgg aagcagcagt gtcgtgggtc gggcagttcg aaaaggccaa cgctaccgtg       420
     accggtcacg ttcggttctt cgatcgggac gtgacactca agggcacaac ttcggctgtt       480
     ctgacgttct gcgccgacga gagcaagggg ttcagcaagg acaaggagac cggcgaggtg       540
     accaagacgc ccgtcaccaa ggacagctac gtccagtaca acaccaggct cgacaagaat       600
     gctgacggtg tctggcagac atcgcagatc ctctccacga ggggggcggc ccagtgccag       660
     gcctag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page