(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5024

AL939122.SCO5024     Location/Qualifiers
FT   CDS_pept        88019..88891
FT                   /transl_table=11
FT                   /gene="SCO5024"
FT                   /gene_synonym="SCK15.26"
FT                   /product="putative oxidoreductase"
FT                   /note="SCK15.26, possible oxidoreductase, len: 290 aa;
FT                   similar to TR:Q9UXP0 (EMBL:AJ011519) Methanolobus tindarius
FT                   F420-dependent N5,N10-methylene-tetrahydromethanopterin
FT                   reductase, putative FfdA, 326 aa; fasta scores: opt: 323
FT                   z-score: 369.8 E(): 4e-13; 28.3% identity in 240 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9KY78"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY78"
FT                   /protein_id="CAB92617.1"
FT                   /translation="MTGLGAVFRPQLAPERLRAVARVADEVGLEELWLWEDCFREGGIS
FT                   TAAAALAWTERVRVGVGLLPVPLRNVAVTAMEAATLHRMFPGRPVLGVGHGVQDWMGQV
FT                   GARAESPLTLLREHLVALRELLRGGRVTSTGRYVRLDDVALDWPPEQPVEVLAGATGPR
FT                   SLRLAGEAADGTVLTANTPPDGVRRARRLIDEGRAASGRTEAHRVVVYLLAATGSGAAE
FT                   RLRNELVAEGVGAVPDLGVAGDAQAVADAVRRLAEAGADTVILQPTGDEPDPEGFVRFA
FT                   AERVRPLVA"
     atgactggac tcggtgccgt attccgcccc cagctcgccc ccgagcggct ccgtgccgtg        60
     gctcgggtcg ccgatgaggt ggggctcgag gagctgtggc tgtgggagga ctgtttccgg       120
     gagggcggga tctccacggc cgcagccgcc ctcgcctgga ccgagcgggt gcgggtcggg       180
     gtcgggctgc tgcccgtgcc gttgcggaac gtggccgtca ccgcgatgga ggccgccacg       240
     ctgcaccgga tgttccccgg ccgccccgtc ctcggcgtgg gacacggcgt gcaggactgg       300
     atgggacagg tcggggcccg ggccgagtcg cccctgacgc tgctgcggga gcatctcgtg       360
     gcgctgcggg agttgctgag gggcggacgg gtgacgtcga cggggcgcta cgtccgactc       420
     gacgacgtcg cgctggactg gccgccggag cagcccgtcg aggtgctcgc cggcgccacc       480
     gggccgcgct cgctgcggct ggccggtgag gccgccgacg gcaccgtgct caccgcgaac       540
     actccgcccg acggggtgcg ccgcgcccgg cggctcatcg acgaagggcg ggcggcgagc       600
     gggcggacgg aggcccacag ggtcgtcgtg tatctcctcg ccgccaccgg atccggtgcc       660
     gctgaacggc ttcggaacga gctggtcgcc gaaggcgtcg gggcggtgcc ggatctcggg       720
     gtcgccggag acgcccaggc cgttgccgac gccgtgcggc ggttggccga ggccggggcc       780
     gacaccgtga tcctccagcc gaccggggac gagcccgatc cggaggggtt cgtccggttc       840
     gccgccgagc gggtccggcc gctggtggcc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page