(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5028

AL939122.SCO5028     Location/Qualifiers
FT   CDS_pept        93012..94337
FT                   /transl_table=11
FT                   /gene="SCO5028"
FT                   /gene_synonym="SCK7.01"
FT                   /product="putative ATP-binding protein"
FT                   /note="SCK7.01, possible ATP-binding protein, len: 441 aa;
FT                   similar to TR:Q9X792 (EMBL:AL049491) Mycobacterium leprae
FT                   putative ATP-binding protein MLCB1222.20, 433 aa; fasta
FT                   scores: opt: 2024 z-score: 2236.8 E(): 0; 72.2% identity in
FT                   428 aa overlap. Contains and match to Prosite entry PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FBP8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP8"
FT                   /protein_id="CAC05873.1"
FT                   /translation="MVTSTKRHKPDRRTYVLDTSVLLADPNALNRFDEHEVVLPIVVVT
FT                   ELEAKRHHPELGYFARQALRLLDEFRVRHGRLDAPIPIGDLGGTVRVELNHSDPSVLPT
FT                   GYRLGDNDSRILAVARNLQAEGFDVTVVSKDLPLRIKASSVGLLAEEYRAELAITDASG
FT                   WTGMSELTLPGEQVDVLFEEGRVYVPEAAGLPVHTGLTIQSERGKALGRVTPDGNVRLV
FT                   RGDREAFGIKGRSAEQRIALDLLLDPDVGIVSMGGRAGTGKSALALCAGLEAVLERRQH
FT                   QKVMVFRPLYAVGGQELGYLPGSEAEKMSPWAQAVFDTLSAVTSREVIEEVTARGMLEV
FT                   LPLTHIRGRSLHDAFVIVDEAQSLERNVLLTVLSRIGANSRVVLTHDVAQRDNLRVGRY
FT                   DGVVAVVEKLKGHPLFAHVTLTRSERSQIAALVTEMLEDGHI"
     gtggtgacca gcacaaagcg ccacaagcca gataggcgca cctacgttct cgacaccagc        60
     gtcctgctgg ccgacccgaa cgccctgaac cgcttcgacg agcacgaggt cgtgctcccc       120
     atcgtcgtgg tgacggagtt ggaggccaaa cggcaccatc ccgaactcgg ctacttcgcc       180
     cggcaggccc tgcgcctgct cgacgagttc cgggtgcggc acggtcgcct cgacgccccc       240
     atcccgatcg gggacctcgg cggcaccgtc cgcgtcgagc tcaaccactc ggaccccagc       300
     gtgctgccca ccggctaccg cctgggggac aacgactccc gcatcctcgc ggtcgcccgc       360
     aacctccagg cggagggatt cgacgtcacc gtcgtctcga aggacctccc gctccggatc       420
     aaggcgtcct ccgtcggact cctggccgag gagtaccgcg ccgagctggc catcacggac       480
     gcctccggct ggaccggaat gtccgaactc accctgccgg gtgagcaggt ggacgtgctc       540
     ttcgaggagg gccgggtcta cgtccccgag gcggccggcc tgcccgtgca caccggtctg       600
     accatccagt cggagcgcgg caaggccctc ggccgggtca cgcccgacgg caacgtccgg       660
     ctggtgcgcg gcgaccggga ggcgttcggc atcaagggcc gcagcgccga gcagcggatc       720
     gcgctcgacc tgctcctcga cccggacgtc ggcatcgtgt cgatgggcgg ccgggccggc       780
     acaggcaagt cggcgctcgc cctgtgcgcg ggcctcgaag cggtcctgga gcgccggcag       840
     caccagaagg tgatggtctt ccggccgctg tacgcggtgg gcgggcagga actcggctac       900
     ctgcccggct ccgaggccga gaagatgagc ccgtgggcgc aggcggtctt cgacacgctg       960
     tcggccgtca ccagccgcga ggtcatcgag gaggtgaccg cgcgcgggat gctggaggta      1020
     ctgccgctca cccacatccg ggggcgctcg ctgcacgacg cgttcgtgat cgtggacgag      1080
     gcgcagtcgc tggagcggaa cgtcctgctg accgtgctgt cccggatcgg ggccaactca      1140
     cgggtcgtac tcacccatga cgtggcacaa cgggacaatc tgcgggtggg ccggtacgac      1200
     ggagtcgtcg ccgtcgtcga gaaactgaag gggcatccgc tcttcgcgca cgtcaccctg      1260
     acgcgctccg agaggtccca gatcgcggcg ctcgtgaccg aaatgctgga ggacggtcac      1320
     atctga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page