(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5031

AL939122.SCO5031     Location/Qualifiers
FT   CDS_pept        complement(97332..97868)
FT                   /transl_table=11
FT                   /gene="SCO5031"
FT                   /gene_synonym="ahpD"
FT                   /gene_synonym="SCK7.04c"
FT                   /product="alkyl hydroperoxide reductase system hypothetical
FT                   protein"
FT                   /note="SCK7.04c, ahpD, alkyl hydroperoxide reductase system
FT                   hypothetical protein, len: 178 aa; identical to previously
FT                   sequenced TR:Q9RN73 (EMBL:AF186371) Streptomyces coelicolor
FT                   A3(2) AhpD, 178 aa"
FT                   /db_xref="GOA:Q7AKI6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004674"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AKI6"
FT                   /protein_id="CAC05876.1"
FT                   /translation="MSLDSLKSAVPDYAKDLKLNLGSVIGNSDLPAQQLWGTVLATAIA
FT                   SRSPIVLRELEPEAKANLSPEAYSAAKSAAAVMAMNNVFYRTRHLLSDHEYGTLRAGLR
FT                   MNVIGNPGVDKVDFELWSFAVSAINGCGMCLDSHEQVLRKAGVDRETIQEAFKIAAVVE
FT                   AVGVTLDAEAVLAAE"
     atgtccctcg actccctgaa gtccgccgtc ccggactacg ccaaggacct gaagctcaac        60
     ctgggttcgg tcatcggcaa ctccgacctc ccggcgcagc agctgtgggg caccgtgctg       120
     gcgaccgcca tcgcctcgcg ctccccgatc gtgctgcgcg agctggagcc ggaggccaag       180
     gcgaacctct cgcccgaggc gtactcggcc gccaagtcgg ccgccgccgt catggcgatg       240
     aacaacgtct tctaccgcac ccggcacctg ctgtcggacc acgagtacgg caccctgcgc       300
     gccggtctgc ggatgaacgt catcggcaac ccgggcgtcg acaaggtcga cttcgagctg       360
     tggtccttcg cagtgtcggc catcaacggc tgcggcatgt gcctggactc gcacgagcag       420
     gtgctccgca aggccggtgt ggaccgcgag acgatccagg aggcgttcaa gatcgccgcc       480
     gtggtcgagg ccgtcggcgt cacgctggac gccgaggcgg tcctcgccgc cgagtag          537
//

If you have problems or comments...

PBIL Back to PBIL home page