(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5034

AL939122.SCO5034     Location/Qualifiers
FT   CDS_pept        complement(99633..101969)
FT                   /transl_table=11
FT                   /gene="SCO5034"
FT                   /gene_synonym="SCK7.07c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK7.07c, possible integral membrane protein, len:
FT                   778 aa; similar to TR:AAF74504 (EMBL:M34538) Streptomyces
FT                   clavuligerus hypothetical 42.6 kDa protein (fragment) 407
FT                   aa; fasta scores: opt: 509 z-score: 559.6 E(): 1.1e-23;
FT                   31.5% identity in 413 aa overlap. Contains possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP3"
FT                   /protein_id="CAC05879.1"
FT                   /translation="MRQWAADLMLGVRFAFTGGREGWTRAVLTAVGVGLGVALLLLTTA
FT                   LPNALTVRHDREAARSDITFATDPMPKADDTLVLARLDDTFRDDDVRGRALEPEGPRAP
FT                   LPPGLEKFPAVGEMVVSPALKKLLNSDSGALLRERLPDRVVGTIAEEGLIGSAELAYYR
FT                   GAEGLAEHITSGRIERIDRFGDPDPGEERSDPVLILLILVVFVVLLMPVAVFIAAAVRF
FT                   GGERRDRRLAALRLVGSDSRMTRRIAAGEAMAGAALGLLFGAGFFMVGRQLAGSAEVFR
FT                   ISVFPSYLNPSPVLALLVAVAVPTAAVLVTLLALRGVVIEPLGVVRAGRPARRQLWWRL
FT                   ILPLAGLAMLYPMIGNGRENGDFNQYLVTGGVVLLLVGVTALLPWVVESVVARLGSGGV
FT                   AWQLAVRRLQLSSGTAARMVNGIAVAVAGAIALQMLFAGVDDDYTKSTGQDVSWAQMEA
FT                   ILPSGVPMDQAAAKFRDTKGVEAVNAFSEGWLGDRPKDPDHGTTLTVGDCASLREIARL
FT                   SSCAEGDVFVVHGAEWDAEEDVTKLAAPGRKLYVDPSYEGIPKRHEIPWTVPQGVKAAK
FT                   PRTGLLAGTDRGGLLITRKAMPEALAPALDGHAYLRLDQSVPDVHDLVRNTTVAIDPLA
FT                   DAVAWAATERTDRFDAIRTGLFVGAACVLALIGASLLVSQLEQLRERKKLLSALVAFGT
FT                   RRRTLSLSVLWQTAIPIVLGLLLASVVGLTLGTVLLKMTSTPVSVDWTGVLAMTGIGAA
FT                   VVLVVTLCSLPPLLRLMRPEGLRTE"
     gtgcgccagt gggccgccga cctgatgctg ggcgtccgct tcgccttcac cggcggccgc        60
     gagggctgga cccgggccgt gctgaccgcc gtgggcgtcg ggctcggcgt ggcgctgctg       120
     ctgctgacga cggcgctccc gaacgcgctc accgtgcggc acgaccggga ggcggcgcgc       180
     tccgacatca ccttcgccac cgacccgatg ccgaaggcgg acgacacgct cgtgctcgcc       240
     aggctcgacg acaccttccg cgacgacgac gtccggggcc gggccctgga gcccgagggc       300
     ccgcgggcac cgctgccgcc ggggctggag aagttcccgg cggtgggcga gatggtggtc       360
     tcccccgcgc tgaagaagct gctgaactcg gactccggcg cgctgctgcg cgagcggctg       420
     ccggaccggg tcgtcggcac gatcgccgag gaggggctga tcggctcggc cgaactcgcc       480
     tactaccggg gcgcggaggg gctcgcggag cacatcacct cgggcaggat cgagcgtatc       540
     gaccggttcg gcgacccgga ccccggggag gagcggtccg acccggtgct gatcctgctg       600
     atcctcgtcg tcttcgtggt gctgctgatg ccggtcgcgg tgttcatcgc cgccgccgtg       660
     cggttcggcg gcgagcgtcg ggaccggcgg ctcgcggcgc tgcgcctggt cggctccgac       720
     agccgcatga cccggcgcat cgccgccggt gaggcgatgg ccggcgcggc gctcgggctg       780
     ctcttcggtg ccgggttctt catggtcgga cggcaactgg cgggcagtgc cgaggtgttc       840
     cgcatcagcg tgttccccag ctatctcaac ccctcaccgg tgctggcgct gctggtggcg       900
     gtggccgtgc cgacggcggc ggtgctggtg acgctgctcg cgctgcgcgg agtggtcatc       960
     gagccgctcg gcgtggtgcg cgcgggccgg ccggcccggc gccaactgtg gtggcggctg      1020
     attctgccgc tggccggact ggcgatgctc tacccgatga tcggcaacgg gcgcgagaac      1080
     ggcgacttca accagtacct ggtgaccggc ggcgtcgtcc tgctcctggt aggcgtgacc      1140
     gcgctgctgc cgtgggtcgt ggagagcgtc gtcgccaggc tcggctccgg cggcgtggcc      1200
     tggcaactgg ccgtgcgcag gctgcagctg agcagcggga cggcggcccg gatggtcaac      1260
     ggcatcgcgg tggccgtcgc cggggcgatc gcgctgcaga tgctgttcgc cggcgtggac      1320
     gacgactaca ccaagtccac ggggcaggac gtgtcgtggg cacagatgga ggcgatcctc      1380
     ccgagcgggg tccccatgga ccaggcggcc gcgaagttcc gcgacaccaa gggggtcgag      1440
     gcggtcaacg ccttctccga gggctggctg ggcgaccgcc ccaaggaccc ggaccacggc      1500
     acgacactga ccgtggggga ctgcgcctcg ctgcgggaga tcgccaggct gtcgtcgtgc      1560
     gccgaagggg acgtcttcgt cgtccacggc gccgagtggg acgccgagga ggacgtgacg      1620
     aagctggccg cgccgggccg gaagctctac gtcgacccgt cctacgaggg catcccgaag      1680
     cgccatgaga tcccctggac ggtgccgcag ggcgtcaagg ccgcgaagcc gcgtaccggt      1740
     ctgctggccg ggaccgaccg gggcggcctc ctgatcaccc gtaaggcgat gccggaggcc      1800
     ctcgcgccgg cgctggacgg acacgcctac ctccggctgg accagtcggt gccggacgtg      1860
     cacgacctgg tacggaacac cacggtggcg atcgacccgc tggcggacgc ggtggcctgg      1920
     gcggcgaccg agcggaccga ccggttcgac gccatccgca ccggcctgtt cgtgggggcg      1980
     gcgtgtgtgc tggcgctgat cggcgccagt ctgctggtct cgcagctgga gcagctgcgc      2040
     gagcgcaaga agctgctgtc ggccctggtc gccttcggca cccggcgccg cacgctcagc      2100
     ctgtcggtgc tctggcagac ggcgattccc atcgtgctcg gcctgctgct cgcctcggtg      2160
     gtgggtctga ccctgggcac ggtgctgctg aagatgacga gcaccccggt cagcgtcgac      2220
     tggaccggcg tcctcgccat gaccggcatc ggcgccgcgg tggtcctggt ggtgacgctg      2280
     tgcagcctgc cgccgctgct gcggctgatg cggccggagg ggctgcgcac ggagtag         2337
//

If you have problems or comments...

PBIL Back to PBIL home page