(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5035

AL939122.SCO5035     Location/Qualifiers
FT   CDS_pept        complement(101972..102661)
FT                   /transl_table=11
FT                   /gene="SCO5035"
FT                   /gene_synonym="SCK7.08c"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="SCK7.08c, possible ABC transporter ATP-binding
FT                   protein, len: 229 aa; similar to TR:CAB81857
FT                   (EMBL:AL161691) Streptomyces coelicolor putative ABC
FT                   transporter ATP-binding protein SCD40A.12c, 246 aa; fasta
FT                   scores: opt: 597 z-score: 668.0 E(): 9.7e-30; 47.6%
FT                   identity in 206 aa overlap. Contains Pfam match to entry
FT                   PF00005 ABC_tran, ABC transporter and match to Prosite
FT                   entry PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FBP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP2"
FT                   /protein_id="CAC05880.1"
FT                   /translation="MTPPAGSLLSADQLRKAYGPTLALDGAEFSIHPGEVVAVMGPSGS
FT                   GKSTLLHCLAGIVPPDSGTITYNGRELSAMSDAQRSALRRSDFGFVFQFGQLVPELTCV
FT                   ENVALPLRLNGTSRKEAERAALSWMERLEVDDLRKKRPGEVSGGQGQRVAVARSLVTNP
FT                   RVLFADEPTGALDSLNGERVMELLTDAARSTNAAVVLVTHEARVAAYSDREIVVRDGKS
FT                   RDMERAV"
     atgactcccc ccgcaggttc cctgctctcg gcggaccagc tccgcaaggc ctacggcccc        60
     accctcgccc tcgacggcgc cgagttctcc atccaccccg gcgaggtggt cgccgtcatg       120
     ggcccctccg gttccggcaa gtcgacgctg ctgcactgcc tcgccggcat cgtgccgccc       180
     gactcgggga cgatcacgta caacgggcgc gagctgtcgg cgatgtccga cgcccagcgc       240
     agtgcgctgc gccgctcgga cttcgggttc gtgttccagt tcggccagct cgtgccggag       300
     ctgacctgtg tcgagaacgt cgccctgccg ctgcgcctga acggcacctc ccgcaaggag       360
     gccgagcggg ccgcgctgag ctggatggag cggctggagg tcgacgacct caggaagaag       420
     cggcccggcg aggtctcggg cggccagggg cagcgggtcg cggtggcgcg ctcgctggtc       480
     accaacccgc gcgtgctctt cgcggacgag ccgaccggcg cgctggactc cctcaacggg       540
     gagcgcgtga tggagctgct cacggacgcg gcccgctcca ccaacgccgc ggtcgtgctg       600
     gtcacgcacg aggcacgggt ggcggcctac tccgaccgcg agatcgtcgt acgcgacggc       660
     aagtcccggg acatggagcg ggccgtatga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page