(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5036

AL939122.SCO5036     Location/Qualifiers
FT   CDS_pept        complement(102658..103182)
FT                   /transl_table=11
FT                   /gene="SCO5036"
FT                   /gene_synonym="SCK7.09c"
FT                   /product="hypothetical protein"
FT                   /note="SCK7.09c, hypothetical protein, len: 174 aa; similar
FT                   to TR:O50432 (EMBL:AL010186) Mycobacterium tuberculosis
FT                   hypothetical 21.1 kDa protein MTV005.12c, 189 aa; fasta
FT                   scores: opt: 183 z-score: 238.8 E(): 7.8e-06; 30.1%
FT                   identity in 186 aa overlap"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP1"
FT                   /protein_id="CAC05881.1"
FT                   /translation="MSIGHTLLGLLESGPRHGYDLKRAFDEKFGHDRPLHYGQVYSTMS
FT                   RLLKNGLVVVDGIEAGGGPERKRYAITDEGITDVQRWLATPEKPEPYLQSTLYTKVVLA
FT                   LLTHRDAADILDTQRSEHLRSMRILTDRKRKGDLADQLICDHALFHLEADLRWLELTAA
FT                   RLDKLREAVTR"
     atgtccatcg gtcacaccct cctggggctc ctggagtccg ggccgcgcca cggttacgac        60
     ctcaagcgcg ccttcgacga gaagttcggt cacgaccggc cgctgcacta cggccaggtc       120
     tactcgacga tgtcccgcct gctgaagaac ggccttgtgg tggtcgacgg catcgaggcg       180
     ggcggcggtc ccgagcgcaa gcggtacgcg atcaccgacg aggggatcac cgacgtacag       240
     cggtggctcg ccacgccgga gaagcccgag ccgtacctcc agtcgacgct gtacaccaag       300
     gtcgtcctcg cgctgctcac ccaccgcgac gccgccgaca tcctcgacac ccagcgttcg       360
     gaacacctgc gcagcatgcg catcctcacc gaccgcaagc gcaagggcga tctcgcggac       420
     cagctgatct gcgaccacgc cctcttccat ctcgaggccg acctgcgctg gctggaactg       480
     accgccgcgc gcctcgacaa gctccgtgag gcggtaaccc gatga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page