(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5037

AL939122.SCO5037     Location/Qualifiers
FT   CDS_pept        complement(103366..103671)
FT                   /transl_table=11
FT                   /gene="SCO5037"
FT                   /gene_synonym="SCK7.10c"
FT                   /product="hypothetical protein SCK7.10c"
FT                   /note="SCK7.10c, unknown, len: 101 aa. Highly hydrophilic.
FT                   Also high in G+C content (80.52 %)"
FT                   /db_xref="GOA:Q9FBP0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP0"
FT                   /protein_id="CAC05882.1"
FT                   /translation="MTSPPEDSAPEDSVRDSAPSEGPAPKRRPHQRKQVLLRLDPQVYE
FT                   ALARWAGDELRSANAQIEFLLRRALAEAGRLPGGTGPLPRRGRPPGGGGPGAAPPP"
     gtgacgagcc cgcccgagga ttccgcgccc gaggattccg tgcgggattc cgcgccgtcc        60
     gagggcccgg cccccaagcg tcggccgcac cagcgcaagc aggtgctgct gcggctggac       120
     ccccaggtct acgaggcgct ggcccgctgg gcgggcgacg agctgcgctc ggccaacgcc       180
     cagatcgagt tcctgctccg cagggcgctg gccgaggccg gccggctgcc cggcggcacc       240
     ggaccgctgc cgcgccgcgg ccgcccgccg gggggcggcg gcccgggggc cgcgccaccc       300
     ccgtga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page