(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5038

AL939122.SCO5038     Location/Qualifiers
FT   CDS_pept        complement(103668..104606)
FT                   /transl_table=11
FT                   /gene="SCO5038"
FT                   /gene_synonym="SCK7.11c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK7.11c, possible integral membrane protein, len:
FT                   312 aa; similar to TR:Q9RDB7 (EMBL:AL136058) Streptomyces
FT                   coelicolor putative membrane protein SCE20.08c, 383 aa;
FT                   fasta scores: opt: 467 z-score: 517.9 E(): 2.2e-21; 31.2%
FT                   identity in 301 aa overlap. Contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9KIM1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KIM1"
FT                   /protein_id="CAC05883.1"
FT                   /translation="MSTHDAPQVTADVPEMPAPRVRENQAHSIGGGFALLLGLVGLLVG
FT                   AGLIAGATAVDSTGGKAVLIIGGILIALAAFLAMCGLNMVAPGEARVVQLFGRYRGTIR
FT                   QDGLRWVNPFTSRTKISTRVRNHETAVLKVNDAYGNPIELAAVVVWRVEDTAQATFEVD
FT                   DYVEFVSTQTEAAVRHIAIEYPYDAHDEDGLSLRGNAEEITEKLAVELHARVEAAGVQI
FT                   IESRFTHLAYAPEIASAMLQRQQAGAVVAARRQIVDGAVGMVEAALARISEQDIVELDD
FT                   ERKAAMVSNLMVVLCGDRAAQPVLNTGTLYQ"
     atgtccacgc acgatgcccc gcaggtcacc gcggatgtgc ccgagatgcc ggcgccgcgg        60
     gtgcgcgaga accaggcgca cagcatcggc ggcggtttcg cgctgctgct cggactggtc       120
     ggactgctcg tcggcgccgg tctgatcgcc ggcgccacgg cggtcgactc gaccggcggc       180
     aaggccgtgc tgatcatcgg cggcatcctg atcgccctgg ccgccttcct cgcgatgtgc       240
     ggcctgaaca tggtggcgcc gggcgaggcc cgcgtggtgc agctgttcgg gcggtaccgg       300
     ggcaccatcc gccaggacgg cctgcgctgg gtcaacccct tcacctcccg caccaagatc       360
     tcgacgcggg tgcgcaacca cgagacggcg gtcctgaagg tcaacgacgc ctacggcaac       420
     ccgatcgagc tggcggcggt cgtggtgtgg cgggtggagg acaccgcgca ggccaccttc       480
     gaggtggacg actacgtcga gttcgtctcc acccagaccg aggcggccgt gcggcacatc       540
     gccatcgagt acccctacga cgcccacgac gaggacggcc tctcgctgcg cggcaacgcc       600
     gaggagatca ccgagaagct cgccgtcgaa ctgcacgcgc gcgtggaggc ggccggcgtg       660
     cagatcatcg agtcgcgctt cacgcacctc gcgtacgcgc cggagatcgc ctcggcgatg       720
     ctccagcggc agcaggccgg tgcggtggtc gccgcgcggc ggcagatcgt ggacggcgcg       780
     gtcggcatgg tcgaggccgc gctcgcccgg atcagcgagc aggacatcgt ggaactggac       840
     gacgagcgca aggcggcgat ggtgtccaac ctgatggtcg tgctctgcgg ggaccgcgcc       900
     gcccagccgg tcctgaacac ggggacgctc taccagtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page