(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5043

AL939122.SCO5043     Location/Qualifiers
FT   CDS_pept        complement(112101..113561)
FT                   /transl_table=11
FT                   /gene="SCO5043"
FT                   /gene_synonym="SCK7.16c"
FT                   /product="putative hydrolase (putative membrane protein)"
FT                   /note="SCK7.16c, probable hydrolase (putative membrane
FT                   protein), len: 486 aa; N-terminal similar to SW:APX_STRGR
FT                   Streptomyces griseus aminopeptidase (EC 3.4.11.-), 284 aa;
FT                   fasta scores: opt: 967 z-score: 1057.3 E(): 0; 53.7%
FT                   identity in 283 aa overlap and C-terminal region similar to
FT                   TR:O69311 (EMBL:D84193) Streptomyces lividans chitinase (EC
FT                   3.2.1.14) ChiB, 610 aa; blastp scores: Score = 87 (30.6
FT                   bits), Expect = 2.1, P = 0.87; Identities = 46/159 (28%),
FT                   Positives = 60/159 (37%). Contains possible hydrophobic
FT                   membrane spanning region"
FT                   /db_xref="GOA:Q9FBN5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN5"
FT                   /protein_id="CAC05888.1"
FT                   /translation="MRTCPAWPPLSHFWRTKVKRRFAVASLSLAVVLGLGTLPAVAAGT
FT                   APAAQSPDVDVTKVKAHLTELHSIAGRNGGTRRSTGQGYRDSVAYVKGKLQAAGYTVTE
FT                   QPCTSGCSSGAGPNLIAEWPHGDANDVYMFGAHLDSVSAGPGMNDNGSGSAALLENALT
FT                   LARQNPTMQGRVRFAWWTDEEQGLNGSDFYVRSLSSAQRSAITAYYNFDMIASTNGGYF
FT                   VNHVTSAAAAPMKAYWDSLGLQPEENTEGAGRSDDYSFEQYGIPTSGYAMGASARKTSA
FT                   QAAKWGGTAGTSYDPCYHRSCDNLDNINTTGLDRASDGIAYTIWQRAVGTGDDGGGDGC
FT                   DTDPVVNGGFESGSSPWTGDTGTIGAHSGQSAHTGTRFAWLAGYGSTHTESVAQTVTVP
FT                   TGCTRLAYWLHIDTDESGTTAYDTFKVKADGTTLATLSNADARDGYVQRTVDLGAYAGR
FT                   QVALSFTGSEDGSLQTGFVLDDVSLLAG"
     atgcgtacat gccctgcgtg gccacccctc agccacttct ggaggaccaa ggtgaaacga        60
     agattcgccg tggcgagcct gtccctcgcc gtcgtgctcg gcctcggcac actccccgcc       120
     gtcgccgccg gcaccgcgcc cgccgcccag tcgcccgacg tcgacgtgac gaaggtgaag       180
     gcgcacctga ccgagctgca ctccatagcc ggacgcaacg gcggcacccg ccgctcgacc       240
     ggccaggggt accgcgactc cgtcgcctac gtgaagggca agctgcaggc ggccggttac       300
     accgtcaccg agcagccgtg cacctccggt tgcagcagcg gcgccggccc caacctgatc       360
     gccgagtggc cgcacggcga cgcgaacgat gtgtacatgt tcggcgccca cctcgacagc       420
     gtctcggcgg gccccggcat gaacgacaac ggctcgggct cggccgccct cctggagaac       480
     gccctgaccc tggcgcggca gaacccgacg atgcagggcc gggtccgctt cgcctggtgg       540
     accgacgagg aacagggcct caacggctcc gacttctacg tccgctcgct ctcctcggcg       600
     cagcggtccg cgatcacggc gtactacaac ttcgacatga tcgcctccac caacgggggc       660
     tacttcgtca accacgtcac ctcggccgcc gccgcgccca tgaaggcgta ctgggactcg       720
     ctgggcctgc aacccgagga gaacaccgag ggcgccgggc gcagcgacga ctactccttc       780
     gagcagtacg gcatcccgac ctccggctac gcgatgggcg ccagtgcccg caagacctcc       840
     gcgcaggccg ccaagtgggg cggcaccgcc ggaacctcgt acgacccgtg ctaccaccgg       900
     tcgtgcgaca acctcgacaa catcaacacc accggcctgg accgggcgtc ggacggcatc       960
     gcgtacacca tctggcagcg cgccgtgggc accggcgacg acggcggcgg cgacgggtgc      1020
     gacaccgacc ccgtcgtcaa cggcggcttc gagagcggca gctcgccgtg gaccggggac      1080
     accggcacca tcggcgccca ctcgggtcag tcggcgcaca ccgggacccg cttcgcgtgg      1140
     ctcgccggtt acggttccac gcacaccgag tcggtcgccc agacggtgac cgtgccgacc      1200
     ggatgcaccc ggctggccta ctggctgcac atcgacaccg acgagtcggg cacgacggcg      1260
     tacgacacct tcaaggtgaa ggccgacggc accacgctcg ccaccctgtc caacgcggac      1320
     gcccgcgacg gctatgtgca gcgcacggtc gacctcggcg cgtacgccgg ccggcaggtg      1380
     gccctgagct tcaccggcag cgaggacggc agcctgcaga ccggcttcgt cctggacgac      1440
     gtgagcctgc tggcgggctg a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page