(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5044

AL939122.SCO5044     Location/Qualifiers
FT   CDS_pept        complement(113742..115418)
FT                   /transl_table=11
FT                   /gene="SCO5044"
FT                   /gene_synonym="fumB"
FT                   /gene_synonym="SCK7.17c"
FT                   /product="fumarate hydratase class I"
FT                   /note="SCK7.17c, fumB, fumarate hydratase class I, len: 558
FT                   aa; similar to SW:FUMB_ECOLI (EMBL:M27058) Escherichia coli
FT                   fumarate hydratase class I, anaerobic (EC 4.2.1.2) FumB,
FT                   548 aa; fasta scores: opt: 2386 z-score: 2782.7 E(): 0;
FT                   64.9% identity in 539 aa overlap. Contains Pfam match to
FT                   entry PF00206 lyase_1, Lyase and match to Prosite entry
FT                   PS00163 Fumarate lyases signature"
FT                   /db_xref="GOA:Q9FBN4"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN4"
FT                   /protein_id="CAC05889.1"
FT                   /translation="MGEMPEFAYTDLLPQGEDTTPYRLVTAEGVATFEADGRTFLKVEP
FT                   EALRKLAEEAVHDIQHYLRPAHLAQLRRIIDDPEASGNDKFVALDLLKNANIAAAGVLP
FT                   MCQDTGTAIVMGKRGQNVLTEGGDEEALSRGIYDAYKNLNLRYSQMAPLTMWEEKNTGS
FT                   NLPAQIELYATDGGAYKFLFMAKGGGSANKSFLYQETKAVLNESSMMKFLEEKIRSLGT
FT                   AACPPYHLAIVVGGTSAEYALKTAKYASAHYLDEIPAEGSELGHGFRDKELEEKVFELT
FT                   QKIGIGAQFGGKYFCHDVRVVRLPRHGASCPVAIAVSCSADRQAVAKITAEGVFLEQLE
FT                   TDPARFLPETTDEHLEEEGDVVKVDLNQPMDDILAELTRHPVKTRLSLTGPLVVARDIA
FT                   HAKIKERLDAGEEMPQYLKDHPVYYAGPAKTPEGYASGSFGPTTAGRMDSYVEQFQAAG
FT                   GSKVMLAKGNRSKQVTDACDAHGGFYLGSIGGPAARLAQDCIKKVEVVEYEELGMEAVW
FT                   KIEVEDFPAFIVVDDKGNDFFQDPAPAPTFTTIPVRGPGLA"
     atgggcgaga tgcctgagtt cgcgtacacc gatctgctcc cccagggcga ggacaccact        60
     ccgtaccggc tggtgaccgc cgagggtgtc gccaccttcg aggccgacgg gcggaccttc       120
     ctcaaggtgg agccggaggc cctgcgcaag ctggccgagg aggccgttca cgacatccag       180
     cactacctgc gcccggcgca cctggcacag ctgcgccgca tcatcgacga cccggaggcg       240
     tccggcaacg acaagttcgt cgccctggac ctgctgaaga acgcgaacat cgcggctgcg       300
     ggcgtgctgc cgatgtgcca ggacaccggc acggcgatcg tcatgggcaa gcgcggccag       360
     aacgtgctca ccgagggcgg tgacgaggag gccctgagcc ggggcatcta cgacgcgtac       420
     aagaacctga acctgcgcta ctcccagatg gccccgctga ccatgtggga ggagaagaac       480
     accggctcca acctccccgc ccagatcgag ctgtacgcga ccgacggcgg cgcctacaag       540
     ttcctcttca tggcgaaggg cggcggctcg gccaacaagt ccttcctcta ccaggagacg       600
     aaggccgtcc tgaacgagtc ctccatgatg aagttcctgg aggagaagat ccgctcgctc       660
     ggcacggccg cctgcccgcc gtaccacctg gcgatcgtgg tcggcggcac gtcggccgag       720
     tacgcgctga agaccgcgaa gtacgcctcc gcgcactacc tggacgagat cccggccgag       780
     ggctcggagc tcgggcacgg cttccgggac aaggagctgg aggagaaggt cttcgagctg       840
     acccagaaga tcggcatcgg cgctcagttc ggcggcaagt acttctgcca cgacgtgcgc       900
     gtggtgcggc tgccccggca cggggcgtcc tgcccggtcg ccatcgcggt gtcctgctcg       960
     gcggaccggc aggcggtcgc gaagatcacc gccgagggcg tcttcctgga gcagctggag      1020
     accgacccgg cgcggttcct gccggagacc acggacgagc atctggagga ggagggcgac      1080
     gtcgtcaagg tcgacctcaa ccagccgatg gacgacatcc tcgccgagct gaccaggcac      1140
     ccggtcaaga cccggctgtc gctgaccggt ccgctggtgg tggcccgcga catcgcgcac      1200
     gccaagatca aggagcggct ggacgcgggc gaggagatgc cgcagtacct gaaggaccac      1260
     ccggtgtact acgcgggccc cgcgaagacg cccgagggct acgcctccgg gtccttcggt      1320
     ccgaccaccg ccgggcgcat ggactcctac gtcgagcagt tccaggcggc gggcggctcc      1380
     aaggtgatgc tggccaaggg caaccggagc aagcaggtca ccgacgcgtg cgacgcgcac      1440
     ggcggcttct acctgggctc gatcggcggg cccgcggcgc ggctcgcaca ggactgcatc      1500
     aagaaggtcg aggtcgtcga gtacgaggag ctcggcatgg aggcggtctg gaagatcgag      1560
     gtcgaggact tccccgcgtt catcgtggtg gacgacaagg gcaacgactt cttccaggac      1620
     ccggcgcccg cgccgacgtt cacgacgatt ccggtacggg ggccgggcct ggcgtaa         1677
//

If you have problems or comments...

PBIL Back to PBIL home page