(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5045

AL939122.SCO5045     Location/Qualifiers
FT   CDS_pept        115654..116337
FT                   /transl_table=11
FT                   /gene="SCO5045"
FT                   /gene_synonym="SCK7.18"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK7.18, conserved hypothetical protein, len: 227
FT                   aa; similar to TR:CAB88834 (EMBL:AL353832) Streptomyces
FT                   coelicolor hypothetical 30.8 kDa protein SCE6.30c, 277 aa;
FT                   fasta scores: opt: 403 z-score: 468.8 E(): 1.2e-18; 38.6%
FT                   identity in 220 aa overlap"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN3"
FT                   /protein_id="CAC05890.1"
FT                   /translation="MDLHKHAPAAAPRTSELRASDADRDRVADMLREALAEGRLTADEH
FT                   AERVEGVLAAKTVGELDVFVRDLPAAHRGRETTAPAPHRPTAGAIPAEPDENVVAVFSS
FT                   AVRKGRWRANRRIHAYAVFGSIEIDLSEAVFEYQQVVIKAFSVFGSVEVRVPENVSVRG
FT                   AGGSVLGSFEVHTLDSSEAEAPVIYVDGWAVLGSVEARPKRGKVVADILDRVHRRVEKG
FT                   LRKHV"
     gtggaccttc acaagcacgc cccagccgcc gccccgcgca cctccgagct gcgcgcctcg        60
     gacgccgacc gcgaccgcgt cgccgacatg ctgcgcgagg ccctcgccga gggacggctc       120
     accgccgacg agcacgccga gcgcgtcgag ggcgtgctgg ccgccaagac cgtgggcgag       180
     ctggacgtct tcgtgcgcga cctgcccgcc gcccaccgcg gccgggagac caccgccccg       240
     gctccccacc gccccaccgc cggcgccatc ccggcggaac ccgacgagaa cgtggtggcg       300
     gtcttcagca gcgccgtccg caagggccgc tggcgggcga accgccgcat ccacgcctac       360
     gcggtcttcg gcagcatcga gatcgacctc agcgaggcgg tcttcgagta ccagcaggtc       420
     gtcatcaagg cgttctccgt cttcggcagc gtcgaggtgc gcgtcccgga gaacgtgtcg       480
     gtgcgcggcg ccggcggcag cgtgctcggc agcttcgagg tccacaccct cgactccagc       540
     gaggccgagg cccccgtcat ctacgtggac ggctgggccg tactgggcag cgtggaggcc       600
     cgccccaagc gcggcaaggt cgtcgccgac atcctcgacc gggtgcaccg acgcgtcgag       660
     aagggtttgc gcaagcacgt gtag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page