(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5047

AL939122.SCO5047     Location/Qualifiers
FT   CDS_pept        complement(117077..118108)
FT                   /transl_table=11
FT                   /gene="SCO5047"
FT                   /gene_synonym="SCK7.20c"
FT                   /product="conserved hypothetical protein GlpX"
FT                   /note="SCK7.20c, conserved hypothetical protein, len: 343
FT                   aa; similar to SW:GLPX_ECOLI (EMBL:Z11767) Escherichia coli
FT                   hypothetical protein GlpX, 336 aa; fasta scores: opt: 789
FT                   z-score: 868.1 E(): 0; 46.5% identity in 325 aa overlap"
FT                   /db_xref="GOA:Q9FBN2"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN2"
FT                   /protein_id="CAC05892.1"
FT                   /translation="MTEHHLPSELDVPSEAPDRNLAMELVRVTEAAAMAAGRWVGRGDK
FT                   NGADGAAVRAMRTLVHTVSMNGVVVIGEGEKDEAPMLFNGERVGDGTGAEVDIAVDPID
FT                   GTTLTANGMTNAIAVLAAAERGSMFDPSAVFYMDKLVTGPEAADFVDINAPVAVNIRRI
FT                   AKAKRRTPEDVTVVILDRPRHQGLIKEVRETGARIKLISDGDVAGSILALREGTGIDLL
FT                   LGIGGTPEGIISACAVKCLGGTIQGKLWPKDAEERQRAVDAGHDLDRVLTTDDLVSGDN
FT                   VFFVATGITDGELLRGVRYRSETATTDSIVMRSKSGTVRRIDSEHRLSKLRAYSAVDFD
FT                   RAK"
     atgaccgagc atcatctccc gtccgagctg gacgtcccct cggaggcccc cgaccgcaac        60
     ctcgccatgg agctcgtgcg ggtcaccgag gccgcggcga tggccgcggg ccgctgggtc       120
     gggcgcggtg acaagaacgg cgccgacggt gccgcggtac gcgccatgcg gaccctcgtc       180
     cacaccgtct cgatgaacgg cgtcgtcgtc atcggcgagg gcgagaagga cgaggccccg       240
     atgctcttca acggagagcg ggtcggcgac ggcaccgggg ccgaggtcga catcgccgtc       300
     gacccgatcg acggcaccac gctgaccgcc aacggcatga ccaacgcgat cgcggtgctg       360
     gccgcggccg agcgcggctc catgttcgac ccgtccgcgg tcttctacat ggacaagctg       420
     gtcacgggcc ccgaggccgc cgacttcgtc gacatcaacg cgcccgtcgc cgtgaacatc       480
     cgccggatcg ccaaggccaa gcggcgcacg cccgaggacg tcaccgtcgt catcctcgac       540
     cggccgcggc accagggcct catcaaggag gtccgggaga ccggcgcccg catcaagctg       600
     atctccgacg gcgacgtggc cggctccatc ctggccctgc gcgagggcac cggcatcgac       660
     ctgctgctcg gcatcggcgg cacgccggag ggcatcatct cggcctgcgc cgtgaagtgc       720
     ctgggcggca ccatccaggg caagctgtgg cccaaggacg ccgaggagcg gcagcgcgcg       780
     gtcgacgccg ggcacgacct ggaccgggtg ctgaccaccg acgacctggt ctccggggac       840
     aacgtcttct tcgtcgccac cggcatcacc gacggcgagt tgctgcgcgg ggtgcggtac       900
     cgctcggaga cggcgacgac cgactcgatc gtgatgcggt ccaagtcggg gacggtgcgg       960
     cggatcgact ccgagcaccg gctgagcaag ctgcgggcgt acagcgcggt ggatttcgac      1020
     cgggcgaagt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page