(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5048

AL939122.SCO5048     Location/Qualifiers
FT   CDS_pept        118244..118768
FT                   /transl_table=11
FT                   /gene="SCO5048"
FT                   /gene_synonym="SCK7.21"
FT                   /product="putative secreted protein"
FT                   /note="SCK7.21, possible secreted protein, len: 174 aa.
FT                   Contains possible N-terminal signal peptide sequence"
FT                   /db_xref="GOA:Q9FBN1"
FT                   /db_xref="InterPro:IPR025339"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN1"
FT                   /protein_id="CAC05893.1"
FT                   /translation="MKGKQKSARDMILSLGVIVLAAGVIWIFIPHDDGEPDVKRVDYRV
FT                   ELLTAQRAASYPVAAPEGLSEDWKPTSVRFRGDDSDAWHLGFRTPDGEYVAVEQSTKKP
FT                   STFIHDASQGGQATERTEEIGGRTWTRYTGGRYDALVLDGTGDMKGATTVVAGTGSFEQ
FT                   LGKMAAALKLA"
     atgaaaggca agcagaagtc ggcccgggac atgattctgt ccctcggggt catcgtcctc        60
     gcggcgggcg tgatctggat cttcatcccg cacgacgacg gcgaaccgga cgtcaagcgg       120
     gtcgactacc gggtcgagct gctgaccgcg cagcgcgccg cgtcgtatcc ggtggcggcg       180
     cccgaggggc tgtccgagga ctggaagccg acctccgtgc gcttccgcgg tgacgactcc       240
     gacgcctggc acctggggtt ccggaccccg gacggcgagt acgtggcggt cgagcagtcc       300
     acgaagaagc cgtccacgtt catccacgac gccagccagg gcgggcaggc gaccgagcgg       360
     accgaggaga tcggcggccg gacctggacg cggtacacgg gcggccggta cgacgcgctg       420
     gtgctggacg gcaccggcga catgaagggc gcgacgacgg tcgtggccgg caccgggtcg       480
     ttcgagcagc tcggcaagat ggcggcggcc ctgaaactgg cctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page