(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5049

AL939122.SCO5049     Location/Qualifiers
FT   CDS_pept        complement(118832..119422)
FT                   /transl_table=11
FT                   /gene="SCO5049"
FT                   /gene_synonym="SCK7.22c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK7.22, hypothetical protein, len: 196 aa; similar
FT                   to TR:P75894 (EMBL:AE000202) Escherichia coli hypothetical
FT                   protein, 196 aa; fasta scores: opt: 466 z-score: 572.4 E():
FT                   2e-24; 40.6% identity in 192 aa overlap and to
FT                   SW:YDFN_BACSU (EMBL:AB001488) Bacillus subtilis putative
FT                   NAD(P)H nitroreductase YdfN, 206 aa; fasta scores: opt: 133
FT                   z-score: 170.9 E(): 0.047; 23.1% identity in 199 aa
FT                   overlap. Contains Pfam match to entry PF00881
FT                   Nitroreductase, Nitroreductase family. Similar also to
FT                   TR:Q9FBV0 (EMBL:AL391072) Streptomyces coelicolor putative
FT                   nitroreductase SC9A4.03c, 202 aa; fasta scores: opt: 599
FT                   Z-score: 706.0 E(): 1.1e-31; 49.474% identity in 190 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9FBN0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBN0"
FT                   /protein_id="CAC05894.1"
FT                   /translation="MSLVLDPAAQDLLFREARTANTFTDEPVTDEQVQAIYDLVKYGPT
FT                   AFNQSPLRITLVRSPEARERLVAHMAEGNRPKTAAAPLVAILSADNEFHEELPELFPHF
FT                   PAAKDAFFSERPVREGAATLNAALQAAYFIVGVRAAGLAAGPMTGLDFEGVRKEFLDDD
FT                   HTPLMVVNIGRPGPDAWFPRSPRLAYDQVVTTV"
     atgtctctcg ttcttgaccc cgccgcccag gacctgctgt tccgcgaggc ccgcacggcg        60
     aacaccttca ccgacgagcc ggtgaccgac gagcaggtgc aggcgatcta cgacctggtc       120
     aagtacggcc cgaccgcctt caaccagtcg ccgctgcgca tcacgctggt ccgctccccc       180
     gaggcccgcg agcgcctggt cgcccacatg gccgagggca accggcccaa gaccgccgcc       240
     gccccgctgg tcgccatcct gtccgcggac aacgagttcc acgaggagct gccggagctc       300
     ttcccgcact tccccgccgc gaaggacgcc ttcttcagcg agcgtccggt ccgcgagggc       360
     gcggccaccc tgaacgccgc cctccaggcc gcgtacttca tcgtcggcgt ccgcgccgcg       420
     ggtctggccg ccggaccgat gaccggcctc gacttcgagg gcgtgcgcaa ggagttcctg       480
     gacgacgacc acaccccgct gatggtcgtg aacatcggcc gtccgggccc ggacgcctgg       540
     ttcccgcgct ccccgcggct ggcctacgac caggtcgtca ccacggtctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page