(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5052

AL939122.SCO5052     Location/Qualifiers
FT   CDS_pept        122428..122535
FT                   /transl_table=11
FT                   /gene="SCO5052"
FT                   /gene_synonym="SCK7.25"
FT                   /product="putative membrane protein"
FT                   /note="SCK7.25, possible membrane protein, len: 35 aa.
FT                   Doubtful CDS. Contains possible hydrophobic membrane
FT                   spanning region"
FT                   /db_xref="GOA:Q9FBM7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM7"
FT                   /protein_id="CAC05897.1"
FT                   /translation="MRVLLRGLGRSLAVGLTCAAVALVYVFVVTRGRWL"
     atgagagtcc tgctgcgcgg actgggccgc tcgctcgccg tcggcctcac ctgcgccgcc        60
     gtcgccctgg tctacgtgtt cgtcgtcacc cggggacggt ggctgtga                    108
//

If you have problems or comments...

PBIL Back to PBIL home page