(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5054

AL939122.SCO5054     Location/Qualifiers
FT   CDS_pept        124102..124416
FT                   /transl_table=11
FT                   /gene="SCO5054"
FT                   /gene_synonym="SCK7.27"
FT                   /product="hypothetical protein SCK7.27"
FT                   /note="SCK7.27, unknown, len: 104 aa"
FT                   /db_xref="InterPro:IPR025629"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM5"
FT                   /protein_id="CAC05899.1"
FT                   /translation="MRPPITSRAGRGPKSTTPLVTRTPHLVPRERIDMTATVKGPASYF
FT                   PSIEKKYGRPVAEWKDLIRSSPLTKHMELVAWLKAEHGLGHGHANALVAHTLAEGPAKG
FT                   "
     atgcggccgc cgatcacttc ccgcgccggc cgcggtccga agagcacgac accactcgtg        60
     acccgtaccc cgcacctcgt ccccagggag cgcatcgaca tgaccgccac cgtgaagggc       120
     ccggcctcgt acttcccgtc catcgagaag aagtacggcc gcccggtcgc ggagtggaag       180
     gacctcatcc ggtcctcgcc gctcaccaag cacatggaac tcgtcgcctg gctcaaggcc       240
     gagcacggcc tgggccacgg gcacgccaac gccctcgtcg cgcacaccct ggccgagggc       300
     ccggcgaagg gctag                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page