(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5055

AL939122.SCO5055     Location/Qualifiers
FT   CDS_pept        complement(124413..124679)
FT                   /transl_table=11
FT                   /gene="SCO5055"
FT                   /gene_synonym="SCK7.28c"
FT                   /product="putative exoribonuclease"
FT                   /note="SCK7.28c, possible exoribonuclease small subunit,
FT                   len: 88 aa; similar to SW:EX7S_ECOLI (EMBL:D00694)
FT                   Escherichia coli exodeoxyribonuclease small subunit (EC
FT                   3.1.11.6) XseB, 79 aa; fasta scores: opt: 129 z-score:
FT                   174.2 E(): 0.031; 35.3% identity in 68 aa overlap and to
FT                   TR:Q9X784 (EMBL:AL049491) Mycobacterium leprae putative
FT                   exodeoxyribonuclease small subunit XseB, 87 aa; fasta
FT                   scores: opt: 231 z-score: 293.6 E(): 7e-09; 55.1% identity
FT                   in 78 aa overlap"
FT                   /db_xref="GOA:Q9FBM4"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBM4"
FT                   /protein_id="CAC05900.1"
FT                   /translation="MTSEVEQPTAMSEALGYEQARDELIEVVRRLEAGGTTLEESLALW
FT                   ERGEELAEVCRRRLDGARARLDAALAEEADPEDGASGADGGGA"
     atgaccagcg aggtggagca gccgacggcg atgtccgagg cgctcgggta cgagcaggcg        60
     cgggacgagc tgatcgaggt cgtccggcgg ctggaggccg gcggtacgac gctggaggag       120
     tccctcgccc tgtgggagcg gggcgaggag ctggcggagg tgtgccgccg ccggctggac       180
     ggcgcgcggg cccgcctgga cgcggcgctg gccgaggagg cggacccgga ggacggagcc       240
     tccggcgcgg acggcggcgg ggcctag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page