(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5056

AL939122.SCO5056     Location/Qualifiers
FT   CDS_pept        complement(124689..125897)
FT                   /transl_table=11
FT                   /gene="SCO5056"
FT                   /gene_synonym="SCK7.29c"
FT                   /product="putative exoribonuclease large subunit"
FT                   /note="SCK7.29c, possible exoribonuclease large subunit,
FT                   len: 402 aa; similar to TR:O53456 (EMBL:AL021897)
FT                   Mycobacterium tuberculosis exonuclease VII large subunit
FT                   XseA or MTV017.61c, 415 aa; fasta scores: opt: 1318
FT                   z-score: 1486.0 E(): 0; 52.3% identity in 407 aa overlap
FT                   and to SW:EX7L_ECOLI (EMBL:J02599) Escherichia coli
FT                   exodeoxyribonuclease large subunit (EC 3.1.11.6) XseA, 456
FT                   aa; fasta scores: opt: 610 z-score: 689.7 E(): 6e-31; 30.8%
FT                   identity in 413 aa overlap"
FT                   /db_xref="GOA:Q9FBM3"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBM3"
FT                   /protein_id="CAC05901.1"
FT                   /translation="MAANSTPEGPLPVGEVSRLIGGWIDRLGAVWVEGQITQLSRRPGA
FT                   GVVFLTLRDPSYDISVSVTCYRQVFDAVADVVGEGARVVVHAKPEWYAPRGQLSLRAAE
FT                   IKPVGVGELLARLEQLKKALAREGLFAAERKQPLPFLPQLIGLVCGRASAAERDVLENA
FT                   RHRWPAVRFEVRNVPVQGVHAVPQVVQAVKELDARDDVDVIVVARGGGSVEDLLPFSDE
FT                   QLVRAVAACRTPVVSAIGHEPDSPLLDLVADLRASTPTDAAKKVVPDVGEEYERVRLLR
FT                   DRARRCVAAFVDREERGLAHALARPSIQDPHRMIEERAEQVTALLDRGRRSLRHHLDRA
FT                   DSELTHTHARVVALSPAATLKRGYAVLQRADGHAVRDPGEVEPGETLRARVSEGDFSVR
FT                   VDA"
     atggctgcca actcgacccc tgaaggtccg ctgcccgtgg gcgaggtgtc ccggctgatc        60
     gggggctgga tcgaccggct cggcgcggtc tgggtcgagg ggcagatcac ccagttgtcg       120
     cggcggccgg gcgccggtgt ggtgttcctg acgctgcgcg acccgtcgta cgacatctcc       180
     gtgagcgtga cctgctaccg gcaggtgttc gacgccgtgg cggacgtggt cggcgagggc       240
     gcgcgggtgg tcgtgcacgc gaagccggag tggtacgcgc cgcgggggca gctgtcgctg       300
     cgggccgccg agatcaagcc ggtgggcgtc ggtgagctgc tggcgcggct ggagcagctg       360
     aagaaggcgc tcgcgcgcga ggggctgttc gcggcggagc ggaagcagcc gctgccgttc       420
     ctgccgcagc tgatcggtct ggtgtgcggg cgggcctcgg ccgccgagcg ggacgtcctg       480
     gagaacgccc ggcaccgctg gcccgccgtc cgcttcgagg tgcgcaacgt cccggtgcag       540
     ggcgtgcacg cggtgccgca ggtggtgcag gcggtgaagg agctggacgc gcgggatgac       600
     gtggacgtga tcgtcgtcgc gcggggcggc ggcagcgtgg aggacctgct gccgttctcc       660
     gacgagcagc tggtgcgggc ggtcgccgcc tgtcgcacgc cggtcgtctc ggcgatcggc       720
     cacgagccgg acagcccgct gctcgacctg gtggccgacc tgcgcgcctc cacgccgacc       780
     gacgccgcga agaaggtcgt gccggacgtc ggcgaggagt acgagcgggt acggctgctg       840
     cgggaccgcg cccggcggtg tgtggcggcg ttcgtcgacc gcgaggagcg cgggctggcc       900
     cacgcgctgg cccggccgtc gatacaggat ccgcaccgga tgatcgagga gcgggccgag       960
     caggtgacgg cgctcctgga ccggggacgc cgttcgctgc ggcaccacct cgaccgggcc      1020
     gactccgagc tgacgcacac gcacgcgcgc gtggtggccc tctcccccgc cgccaccctc      1080
     aagcgcgggt acgcggtgct ccagcgggcc gacggccacg cggtccgcga ccccggtgag      1140
     gtggagcccg gcgagaccct gcgggcccgg gtgtccgagg gcgatttctc cgtacgagtc      1200
     gacgcatag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page