(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5060

AL939122.SCO5060     Location/Qualifiers
FT   CDS_pept        complement(129806..130408)
FT                   /transl_table=11
FT                   /gene="SCO5060"
FT                   /gene_synonym="SCBAC20F6.03c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCBAC20F6.03c, possible integral membrane protein,
FT                   len: 200 aa. Contains possible hydrophobic membrane
FT                   spanning regions and high G+C content in N-terminal region"
FT                   /db_xref="GOA:Q9ADE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE7"
FT                   /protein_id="CAC37448.1"
FT                   /translation="MEQHRTRPAQYGPRRSGAPLPAQGRGGAVARPPAGRVGPPAGRRP
FT                   EPVRPAPGAPSPVARVVRALRGMPNPRLTGLGSGLFCAAVMTLLGFLDELLFGSSLTAY
FT                   GVLFVPVSLLTALWVRRGDLLTAPVVVPIAFAVGLVPVAESGDGGLGGRLMGIVTALAT
FT                   EAGWLYGGTLVAGSTVIVRRIRLMRRRAAAARNRPPA"
     gtggagcaac acaggacgcg acctgcccag tacggaccgc gacgaagcgg ggcgccgctg        60
     cccgcacagg ggcggggcgg tgccgtcgcg cggccgcctg cggggcgggt cgggccgccc       120
     gcgggacggc gcccggaacc ggtgcggccg gctccggggg ccccttcgcc ggtggcgagg       180
     gtggtgcgtg ccctgcgcgg gatgcccaat ccgcggttga cggggctggg cagcggcctg       240
     ttctgcgcgg cggtgatgac cctgctgggc ttcctggacg agctgctgtt cggctcgtcc       300
     ctcaccgcgt acggggtgct gttcgtgccg gtgagtctgc tcaccgcgct ctgggtgcgc       360
     cggggcgacc tgctgaccgc ccccgtcgtc gtgccgatcg ccttcgccgt gggcctggtg       420
     cccgtggcgg agagcgggga cggcggtctc ggcggacggc tgatggggat cgtgaccgcg       480
     ctggccaccg aggccgggtg gctgtacggc gggacgctgg tcgccgggtc gaccgtgatc       540
     gtccgccgga tccggctgat gcggcgccgg gccgccgccg cccgcaaccg gccccccgcg       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page