(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5064

AL939122.SCO5064     Location/Qualifiers
FT   CDS_pept        132446..134848
FT                   /transl_table=11
FT                   /gene="SCO5064"
FT                   /gene_synonym="SCBAC20F6.07"
FT                   /product="putative bifunctional protein"
FT                   /note="SCBAC20F6.07, possible bifunctional protein, len:
FT                   800 aa; N-terminal domain does not present similarity to
FT                   any known protein and C-terminal half is similar to the
FT                   C-terminal domain of may prokaryotic putative helicases,
FT                   e.g. TR:Q9CE08 (EMBL:AE006434) Lactococcus lactis (subsp.
FT                   lactis) SWI/SNF family helicase Snf, 1034 aa; fasta scores:
FT                   opt: 317  Z-score: 332.6  bits: 72.8 E(): 6.1e-11; 29.817%
FT                   identity in 436 aa overlap. Contains Pfam match to entry
FT                   PF00176 SNF2_N, SNF2 and others N-terminal domain and Pfam
FT                   match to entry PF00271 helicase_C, Helicase conserved
FT                   C-terminal domain"
FT                   /db_xref="GOA:Q9ADE3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE3"
FT                   /protein_id="CAC37452.1"
FT                   /translation="MVPILPAVVSLGGEWLPRGSVDQQGAVNARRGPVWAVERCGEGQR
FT                   GAGSVGRGERDTVARGTRLYEAAQAVVGDHARAVEAVRAALKPIHDEAVKRELDAIPVA
FT                   RLQDVTEGRLRLGSVEKSGLRTLGRVLEAGPYRLRQIPGVGQRTVDQILAAARRLSEAV
FT                   HETVAVHIDVDRPEPRTTALVMALHVLVEAGPEARRAVDKATVLTERLGPLLADAGPAA
FT                   GRVRMLLAGREKKARAWAAVAATRSLVDEAEQAGLPGLLAQASVDLLRGTASDVAAWVD
FT                   FELRSAEYYSLLAEISGRPPDAAAVEGFLPDEVAERVRTQHLDDTHRRVSLRGYQAFGA
FT                   RFALAQRKVILGDEMGLGKTIQAIAVLAHLAAEGQSHFMVVCPASVLVNWTREIEARSA
FT                   LRVMVLHGPDRHYAFADWKGRGGVGVTTFDALRGFPAPGGGEVGLLVVDEAHSVKNPKA
FT                   KRSQAVGLWAERCERTLFMTGTPMENRVAEFRNLVQMLDGDVADSLGERDALAGSVTFR
FT                   KAVAPVYLRRNQEDVLTELPSLQQTDEWEELSASDEEAYREAVRAGNFMAMRRAAYMSS
FT                   GNSAKLERLREIVQEAGENGQKTVVFSNFKDVLAVVKEALAVETTRVTPVFGPLTGGVP
FT                   AQRRQEIVDDFAGVQGPAVLLGQIQAAGVGLNMQAASVVVICEPQIKPTIEHQAVARAH
FT                   RMGQVRPVRVHRLLATGGVDERMVKMLEAKTRLFDAYARRSAVAEATPDAVDVSDTELA
FT                   RRIVEEEQARLGMTDERPTSSEWGVPRSAASPQDPLNGRRESTNANE"
     atggtgccga tcctaccggc ggtcgtaagc ctggggggtg aatggctgcc ccgaggttcg        60
     gttgatcagc agggagctgt gaatgcccgt cgaggccccg tgtgggcggt ggaaagatgc       120
     ggggagggcc agagaggggc gggaagcgtg gggcgtggcg agcgggacac agtcgcgagg       180
     ggaacgcgac tgtacgaggc ggcgcaggca gtggtcggtg accatgcacg ggcagtggag       240
     gcggtacggg cagcgctgaa accgatccac gatgaggcgg tgaagcggga gctcgacgcc       300
     attcccgtcg ctcggctgca ggacgtcacc gaagggcggc tgcggctggg gagcgtcgag       360
     aagagcggac tgcgcaccct gggcagggtt ctcgaagcgg gcccctaccg gctgcggcag       420
     attcccggtg tcgggcagcg caccgtcgac cagatactcg ccgccgcccg ccggctttcc       480
     gaggccgtgc acgagaccgt ggccgtccac atcgacgtgg accggccgga accgcgcacc       540
     accgcgctcg tcatggccct gcacgtactg gtggaagccg gcccggaggc ccggcgtgcg       600
     gtcgacaagg ccaccgtcct gacggaacgg ctcggtccgc tgctggccga cgctgggccc       660
     gccgccggaa gggtccggat gctgctggcc ggccgggaga agaaggctcg cgcgtgggcg       720
     gcggtcgccg cgacccggtc gctggtggac gaggcggagc aggccggcct gcccgggctg       780
     ctcgcccagg cgtcggtgga cctgctccgg gggactgcgt ccgacgttgc ggcctgggtg       840
     gacttcgaac tccgctccgc cgagtactac agcctgctcg ccgagatctc cggacggccg       900
     ccggacgcgg ctgccgtaga ggggttcttg ccggacgagg ttgcagagcg ggtacggacc       960
     cagcacctcg acgacacgca ccggcgggtc tccctgcgcg gctaccaggc gttcggcgca      1020
     cggttcgcgc ttgcgcagcg caaggtgata ctcggcgacg agatgggcct cgggaaaacc      1080
     atccaggcga tcgccgtcct cgcccacctg gccgccgagg gacagagtca cttcatggtc      1140
     gtctgccccg cgagcgtcct cgtgaactgg acacgggaga tcgaggcccg cagtgccctg      1200
     cgcgtcatgg tgctccacgg tcccgaccgg cactacgcgt tcgccgactg gaaggggcgg      1260
     ggtggcgtcg gggtgaccac gttcgacgcg ctgcgcggct ttcccgctcc gggcggcggg      1320
     gaggtcgggc tgctggtggt cgacgaagcg cactccgtga agaacccgaa ggccaagcgg      1380
     tcccaggcgg tcggtctgtg ggcggagcgt tgcgagcgca ccctattcat gaccggaacc      1440
     ccgatggaga acagggtcgc ggagttccgc aacctggtcc agatgctcga cggcgatgtc      1500
     gcggactccc tcggtgaacg ggacgcgttg gccggatcgg tcacctttcg caaggctgtg      1560
     gccccggtct atctgcggcg caaccaggag gacgtgctga cggaactccc gagccttcag      1620
     cagaccgacg agtgggagga gttgagcgct tcggacgagg aggcgtaccg cgaagccgtg      1680
     cgcgcgggca acttcatggc catgcgcagg gccgcgtaca tgagctccgg gaattcggcc      1740
     aagctggaac ggcttcggga gattgttcag gaggccggcg agaacgggca gaagacggtg      1800
     gtcttctcca acttcaagga cgtactggcc gtggtgaagg aggccctcgc ggtcgaaacc      1860
     accagggtca ctccggtgtt cggtccgctt accggcggcg tcccggccca gcgccgccag      1920
     gagatcgtcg acgacttcgc cggtgtccag ggtccggcgg tgctcctggg gcagatccag      1980
     gcagcgggtg tcggcctcaa catgcaggcc gcttccgtcg tcgtcatctg cgaaccccag      2040
     atcaagccga ccatcgagca tcaggcggtg gcccgggccc accgtatggg ccaggtcagg      2100
     ccggttcgag tgcaccgtct cctcgccacc gggggcgtgg acgaacgcat ggtgaagatg      2160
     ctggaggcca agacgcgcct gttcgatgcc tatgctcgcc gcagcgccgt ggccgaagcc      2220
     accccggacg cggtcgacgt gtcggacacc gagctggcac gtcggatcgt cgaggaggaa      2280
     caggctcgcc tgggtatgac ggacgagagg cccacgtcat cggagtgggg tgtcccgcgg      2340
     tccgcagcca gtccgcagga ccccctgaac ggccgtcggg agtccacgaa tgccaacgag      2400
     taa                                                                    2403
//

If you have problems or comments...

PBIL Back to PBIL home page