(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5069

AL939122.SCO5069     Location/Qualifiers
FT   CDS_pept        141271..142227
FT                   /transl_table=11
FT                   /gene="SCO5069"
FT                   /gene_synonym="SCBAC20F6.12"
FT                   /product="putative oxidoreductase"
FT                   /note="SCBAC20F6.12, possible oxidoreductase, len: 318 aa;
FT                   similar to many oxidoreductases/dehydratases, e.g.
FT                   TR:Q9WX20 (EMBL:AL079345) Streptomyces coelicolor putative
FT                   dehydrogenase SCE68.12c, 318 aa; fasta scores: opt: 998
FT                   Z-score: 1062.9  bits: 204.9 E(): 1.3e-51; 52.997% identity
FT                   in 317 aa overlap. Contains Pfam match to entry PF00107
FT                   adh_zinc, Zinc-binding dehydrogenases"
FT                   /db_xref="GOA:Q9ADD8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADD8"
FT                   /protein_id="CAC37457.1"
FT                   /translation="MRAVQFDRFGPPDVLRVNDVPAPRPGPGEVLVEVRAASVDAGETA
FT                   FRAGRMRRVTRVRFPRGLGSDFAGRVAALGSGVRAWSVGDAVWGLMPHLTFGAIADYVA
FT                   VPEQRLARAPQNLDLLEAAALPVVGTTAMTALSGKARLQPGERLLVRGATGGVGSVAVQ
FT                   LGKALGAHVTALAAARNLDWITRLGADEAVDYRTTRPEDLDRFDVIVDVVGTDLGAYRK
FT                   RLARGGRLVALSFDSDRVVSSMLGIALRAAATPRRVKMFSNNPSADRIAELTRAVEAGT
FT                   IRPVVDTVFPMRDIAAVHQRLEAGGVRGKYVVDLRLP"
     atgcgcgccg tacagttcga ccgttttggc ccgcccgacg ttctgcgcgt caacgacgtc        60
     cccgcgcccc gacccgggcc gggagaagtc ctcgtcgagg tgcgcgccgc gagcgtggac       120
     gccggtgaga ccgccttccg ggcgggcagg atgcgccggg tgacccgcgt ccgcttcccc       180
     cgcggcctgg gcagcgactt cgccggccgg gtcgcggccc tcggcagcgg cgtacgcgcc       240
     tggagcgtgg gggacgcggt gtgggggctg atgccgcacc tcaccttcgg ggcaatcgcc       300
     gactacgtcg cggtgcccga gcagcggctg gcccgggctc cgcagaacct ggacctgctc       360
     gaagccgccg ccctgccggt ggtgggcacc accgcgatga cggccctgag cggcaaggcg       420
     cgactccagc ccggggaacg gctcctggtc cgcggcgcca ccggcggcgt cggcagcgtc       480
     gccgtgcagc tgggcaaggc gctgggcgcg cacgtcaccg ccctcgccgc cgcccgcaac       540
     ctcgactgga tcacccggct gggggcggac gaggccgtgg actaccgcac gacccggccc       600
     gaagacctcg accggttcga cgtgatcgtc gacgtcgtcg gcaccgacct gggtgcctac       660
     cggaagcggc tggcccgcgg cggacgtctg gtcgccctct ccttcgactc ggaccgcgtc       720
     gtctcctcca tgctcggcat cgccctgcgg gcggccgcca ctccccggcg cgtcaagatg       780
     ttcagcaaca acccctcggc cgaccggatc gccgaactca cccgggccgt cgaggcgggc       840
     acgatccggc cggtggtcga caccgtcttc cccatgcggg acatagcggc ggtccaccag       900
     cggctcgaag ccggcggcgt ccgcggcaag tacgtcgtcg acctgcggct tccctag          957
//

If you have problems or comments...

PBIL Back to PBIL home page