(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5072

AL939122.SCO5072     Location/Qualifiers
FT   CDS_pept        144323..145246
FT                   /transl_table=11
FT                   /gene="SCO5072"
FT                   /gene_synonym="SCBAC20F6.15"
FT                   /product="hydroxylacyl-CoA dehydrogenase"
FT                   /note="SCBAC20F6.15, ORF1 hydroxylacyl-CoA dehydrogenase,
FT                   len: 307 aa; identical to previously sequenced TR:Q53926
FT                   (EMBL:X62373) Streptomyces coelicolor hydroxylacyl-CoA
FT                   dehydrogenase ORF1, 307 aa. Contains Pfam matches to
FT                   entries PF02737 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase,
FT                   NAD binding domain and PF00725 3HCDH, 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain. Contains possible
FT                   hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q7AKI1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKI1"
FT                   /protein_id="CAC37460.1"
FT                   /translation="MSTVTVIGAGTIGLGWINLFSARGLTVRVNSRRPDVRRVVHEALE
FT                   LFSPGRVDELAARIEYEPDVGRAVAGADVVSENAPDDLPLKQRLFAEIGAAAPDHALVL
FT                   SSTSKLLPDELSRDMPGPGRLVVAHPFNPPHIVPLVEVVRGERTDPEAVERTLAFLASV
FT                   GRTPVVVRRALPGFAANRLQSALLRESIHLVLEGVVTVEELDRIVTDSIGLRWSTIGPF
FT                   HAFHLGGGPGGLRKWLEHLGSGLEQGWRGLGQPALTPQAVEALVAQTEAAYGHRPYAEL
FT                   VRDRDDRHLAVLAALERTEQPQEETK"
     atgagcaccg tgacagtgat cggggcgggc acgatcggcc tgggatggat caacctgttc        60
     agcgcccgcg ggctgaccgt acgcgtcaac agccgtcggc ccgacgtccg gcgcgtcgtg       120
     cacgaggcgc tcgagctgtt ctccccgggg cgggtggacg agctggcggc gcgcatcgag       180
     tacgagccgg acgtcggccg ggcggtggcc ggggcggacg tcgtctccga gaacgccccc       240
     gacgacctgc cgctcaagca gcggttgttc gcagagatcg gagcggccgc cccggaccac       300
     gccctcgtgc tgtcctcgac gtcgaagctg cttcccgacg agctgagtcg ggacatgccg       360
     ggaccgggcc ggctggtcgt cgcgcatccg ttcaacccac cgcacatcgt tccgctggtc       420
     gaggtggtcc gcggcgagcg caccgacccg gaggccgtcg aacggacact ggccttcctg       480
     gcgtcggtcg ggcggacccc cgtcgtggtg cgcagggcgc tgcccggctt cgcggccaac       540
     cggctgcagt cggcgctgct gcgcgagagc atccacctcg tcctcgaagg cgtggtgacc       600
     gtcgaggagc tcgaccggat cgtcaccgac tcgatcggcc tgcgctggtc caccatcggg       660
     ccgttccacg cgttccacct gggcggcggt cccggcggcc tgcgcaagtg gctcgagcac       720
     ctcggcagcg gcctcgaaca gggctggcgt gggctcggac agcccgccct caccccgcag       780
     gccgtcgagg ctctggtcgc acagaccgaa gccgcctacg gacaccggcc ctacgccgaa       840
     ctggtccggg accgtgacga ccggcacctc gccgtactgg ccgccctgga gcggaccgag       900
     cagccccagg aggagaccaa gtga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page