(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5074

AL939122.SCO5074     Location/Qualifiers
FT   CDS_pept        146299..146943
FT                   /transl_table=11
FT                   /gene="SCO5074"
FT                   /gene_synonym="SCBAC20F6.17"
FT                   /product="putative dehydratase"
FT                   /note="SCBAC20F6.17, possible dehydratase, len: 214 aa;
FT                   identical to previously sequenced TR:Q53928 (EMBL:X62373)
FT                   Streptomyces coelicolor ORF 3, 214 aa. Similar to TR:Q56172
FT                   (EMBL:L37334) putative dehydratase from granaticin
FT                   biosynthesis cluster of Streptomyces violaceoruber Tu22
FT                   (221 aa) fasta scores; opt: 349, Z-score: 400.9, E():
FT                   1.1e-14, 35.465% identity (37.195% ungapped) in 172 aa
FT                   overlap."
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADD7"
FT                   /protein_id="CAC37462.1"
FT                   /translation="MTSSLHHAIRLTTASAIALGGLVTLGTSAHAASVAVPYECRTWVQ
FT                   GNTHPVYDYARGFDVSVPASVRAGKKFKATYDPDPITAFAEYNQIVNDVRIAYRIPDGA
FT                   KVHKVRLTGGSGLGDSDVRVQVKGRDIVVSASGPFQGGVEFDLPTLKVTYKAPKTTGPL
FT                   NFVSGGSGYEDPGFYWYRYQPILDEWGPFECFPDPAKPEAVLASTQVKKHK"
     atgacctcgt cgctgcacca cgcgatacgt ctgaccaccg cgtccgccat cgccctgggc        60
     ggactcgtga ccctggggac cagcgcgcac gccgcgagcg tcgccgtgcc gtacgagtgc       120
     cgcacctggg tgcagggcaa cacgcacccg gtctacgact acgcgcgcgg cttcgacgtc       180
     agcgtgcccg cctcggtccg cgcgggcaag aagttcaagg ccacctacga tcccgacccg       240
     atcaccgcct tcgccgagta caaccagatc gtcaacgacg tgcggatcgc ctaccggatc       300
     ccggacggcg cgaaggtcca caaggtgcgg ctcaccggcg gcagcggtct cggcgactcc       360
     gacgtccggg tccaggtcaa gggccgggac atcgtcgtca gcgcctccgg ccccttccag       420
     ggcggtgtcg agttcgacct gccgacgctg aaggtcacct acaaggcgcc gaagaccacc       480
     ggcccgctca acttcgtctc gggcggctcg ggttacgagg accccggctt ctactggtac       540
     cgctaccagc cgatcctgga cgagtggggc cccttcgagt gcttccccga cccggcgaag       600
     cccgaggccg tcctggccag cacccaggtc aagaagcaca agtag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page