(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5075

AL939122.SCO5075     Location/Qualifiers
FT   CDS_pept        146977..147897
FT                   /transl_table=11
FT                   /gene="SCO5075"
FT                   /gene_synonym="ORF4"
FT                   /gene_synonym="SCBAC28G1.01"
FT                   /gene_synonym="SCBAC20F6.18"
FT                   /product="putative oxidoreductase"
FT                   /note="SCBAC28G1.01, possible oxidoreductase, previously
FT                   sequenced as ORF4, len: 167 aa; identical to C-terminal
FT                   region of previously sequenced TR:Q53929 (EMBL:X62373)
FT                   Streptomyces coelicolor ORF4, 306 aa; fasta scores: opt:
FT                   1029 Z-score: 1146.7 bits: 219.4 E(): 2.9e-56; 95.808%
FT                   identity in 167 aa overlap. Contains match to Prosite entry
FT                   PS01162 Quinone oxidoreductase / zeta-crystallin signature"
FT                   /note="SCBAC20F6.18, ORF4, possible oxidoreductase, len:
FT                   170 aa; identical to N-terminal region of the previously
FT                   sequenced TR:Q53929 (EMBL:X62373) Streptomyces coelicolor
FT                   ORF 4, 306 aa. Contains match to Prosite entry PS01162
FT                   Quinone oxidoreductase / zeta-crystallin signature"
FT                   /db_xref="GOA:Q8CJS3"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJS3"
FT                   /protein_id="CAD55222.1"
FT                   /translation="MPKAVAIHQFGGPDVLGLVDVPEPVPGPGQVTVRVRAAGVNGFDC
FT                   RVRSGGMRGRYPVEFPQIIGNEFAGVVERTGPEATGFAPGDEVLGFAVLQSGTELLAVG
FT                   ADQITVKPPELSWEVAGSLSAVGQTADIALAELRVGPGDTVLVHAAAGGVGSLAVQLVR
FT                   ERGGTAIGSAGEHNHDYLRSLGALPVAYGPGFADRVRALAPNGVDAALDCHGGPEALAV
FT                   SLELVADRARIATVANFRAAAQEGIVMPRVVRSAERLAALAALCAEGRLRPHVEAVLPF
FT                   AKAAEAHHRLEQGHVRGKLVLVPDL"
     atgcccaagg ccgtagccat ccaccagttc ggcgggccgg acgtactggg cctcgtcgat        60
     gtccccgagc cggtgccggg accgggccag gtgaccgtcc gagtgcgggc cgccggagtc       120
     aacgggttcg actgccgggt gcgctccggc ggcatgcgcg gtcgctatcc ggtcgagttc       180
     ccgcagatca tcggcaacga gttcgccggg gtcgtcgagc ggaccggacc ggaggcgacc       240
     gggttcgcgc ccggcgacga ggtgctcggg ttcgccgtgc ttcagtccgg caccgagctg       300
     ctcgccgtcg gcgcggacca gatcaccgtg aaaccgccgg agctgtcgtg ggaggtcgcg       360
     ggatccctct cggccgtcgg acagaccgcc gacatcgccc tggccgaact gcgggtcggc       420
     cccggggaca ccgtgctcgt gcacgccgcg gccggcggcg tcggcagcct cgccgtccag       480
     ctcgtccggg agcggggcgg cacggcgatc ggcagcgccg gcgagcacaa ccacgactac       540
     ctgcggtcgt tgggcgcact gcccgtcgcc tacggcccgg gcttcgccga ccgggtgcgg       600
     gccctggccc cgaacggcgt cgacgccgcc ctcgactgcc acggcggacc ggaagccctc       660
     gccgtgtcgc tcgaactcgt cgcggaccgg gcccggatcg ccaccgtcgc caacttccgc       720
     gccgcggccc aggagggcat cgtcatgcca cgggtggtgc ggtccgccga gcggctcgcc       780
     gcgctggccg cactctgcgc cgagggccgg ctgcggccgc acgtcgaggc cgtcctgccc       840
     ttcgccaagg cggccgaggc ccatcaccgg ctggagcagg gccatgtccg gggcaagctc       900
     gtcctggtgc cggacctgtg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page