(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5076

AL939122.SCO5076     Location/Qualifiers
FT   CDS_pept        147894..149495
FT                   /transl_table=11
FT                   /gene="SCO5076"
FT                   /gene_synonym="actVA1"
FT                   /gene_synonym="SCBAC28G1.02"
FT                   /product="integral membrane protein"
FT                   /note="SCBAC28G1.02, actVA1, probable integral membrane
FT                   protein, len: 533 aa; identical to previously sequenced
FT                   TR:Q53903 (EMBL:X58833) Streptomyces coelicolor 6 ActVA
FT                   region genes of the actinorhodin biosynthetic gene cluster,
FT                   ActVA1, 533 aa. Contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q7AKH9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH9"
FT                   /protein_id="CAC44189.1"
FT                   /translation="MTANPGRPGGPADQGHPRRWAILGVLVLSLVGIILDNTVLNVTLR
FT                   TLTDPEQGLGASHSQVEWVLSAYTLAFAATLFTWGVLGDRLGRRRVLLLGLGLFGLSSL
FT                   AGAYAGSPEQLIAARACMGVSGAAVLPSTLATIAAVFPLRERPKALGIWAASVGFALGI
FT                   GPVTGGILLAHFWWGSVLLVNVPLMAGCLVAVVLVVPETRGTAGRRVDAAGLLLSIAGV
FT                   VPLVYAIIEAGRSGGVTRPAVWAAGLAGLGLLLVFLWHERRTPEPSLELGFFRMKAFST
FT                   AVAAVGFVSFAMMGFLFFSAFYLQSVRGYTPLQAGGCTVALAVANVVCGPLSTVLVRSI
FT                   GPRNVCAAGMLAVTASLCGVTFVTQHAPVWLILVLFAALGAGVACVMPTAAVSIMNAIP
FT                   REKAGVASAMNNTVRQLGGALGVAVLGSLMGAAYRRGIEDELAVLPPSARHQAGESLDA
FT                   TLLAATRLGESGLVGPARQAFLDAMHLAAGAAAAVALVGALAVLRWLPSSVTTPTPPAG
FT                   AVPGREHSDHLKVQGS"
     gtgacggcga accccggccg tccgggcggc ccggcggacc agggccaccc gcgccgctgg        60
     gccatcctcg gggtgctggt cctcagcctg gtcggcatca tcctcgacaa caccgtgctc       120
     aacgtgacgc tgcgcaccct caccgacccc gagcagggcc tgggcgcctc gcacagccag       180
     gtggaatggg tgctcagcgc ctacaccctg gccttcgcgg cgacgctgtt cacctgggga       240
     gtgctgggcg accgactggg ccgcaggcgg gtactcctgc tgggcctcgg cctgttcgga       300
     ctgtcgtccc tggccggggc ctacgccggg tcgccggagc agctcatcgc cgcccgtgcc       360
     tgcatggggg tgagcggcgc ggcggtgctg ccgagcacac tcgccaccat cgccgccgtc       420
     ttcccgctgc gcgagcggcc caaggccctc gggatctggg cggcctcggt cggcttcgcc       480
     ctcggcatcg ggcccgtcac cggcgggata ctgctcgcgc acttctggtg gggctcggtc       540
     ctgctggtca acgtgcccct catggccggg tgcctggtcg cggtggtgct ggtggtgccc       600
     gagacccggg gcacggcggg caggcgcgtc gacgcggccg gactgctgct ctcgatcgcg       660
     ggtgtcgtgc cgctcgtcta cgcgatcatc gaggccggcc ggagcggcgg ggtcacccgg       720
     cccgcggtct gggcagccgg cctggcgggc ctcggcctgc tcctcgtgtt cctgtggcac       780
     gagcgccgta ccccggaacc ctcgctggag ctcggcttct tccggatgaa ggccttctcc       840
     accgccgtcg cggccgtcgg cttcgtcagc ttcgcgatga tgggcttcct cttcttcagc       900
     gccttctacc tgcagagcgt gcgcggctac acacccctgc aggccggggg atgcaccgtg       960
     gcactggccg tcgcgaacgt ggtctgcgga ccgctcagca cggtcctggt gcgttcgatc      1020
     ggcccccgga acgtgtgcgc ggcgggcatg ctggccgtca ccgcatcgct ctgcggggtc      1080
     accttcgtga cccagcacgc acccgtatgg ctgatcctcg tcctgttcgc cgcgctgggg      1140
     gcgggcgtag catgcgtcat gccgaccgcg gccgtgtcca tcatgaacgc gatcccacgc      1200
     gagaaggcgg gcgtcgcctc ggcgatgaac aacaccgtgc gccagctggg cggcgccctg      1260
     ggcgtcgcgg tgctcggttc cctcatgggc gccgcgtacc gccgcggcat cgaggacgag      1320
     ctcgccgtac tgccgccctc cgcgcggcac caggccggcg agtccctgga tgccaccctg      1380
     ctggccgcga ctaggctggg ggagagcgga cttgtcggcc ccgcgcgcca ggcattcctg      1440
     gacgccatgc acctggccgc cggggccgct gccgcggtgg cgctcgtggg ggcccttgcc      1500
     gtgctccgct ggctgccctc ctccgtcacg actccgacgc ccccggcagg ggccgtgccc      1560
     ggccgggagc attccgatca cctcaaggtc caaggaagct ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page