(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5077

AL939122.SCO5077     Location/Qualifiers
FT   CDS_pept        149497..149892
FT                   /transl_table=11
FT                   /gene="SCO5077"
FT                   /gene_synonym="actVA2"
FT                   /gene_synonym="SCBAC28G1.03"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC28G1.03, actVA2, hypothetical protein, len: 131
FT                   aa; identical to previously sequenced TR:Q53904
FT                   (EMBL:X58833) Streptomyces coelicolor 6 ActVA region genes
FT                   of the actinorhodin biosynthetic gene cluster, ActVA2, 131
FT                   aa"
FT                   /db_xref="GOA:Q93IZ3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024031"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IZ3"
FT                   /protein_id="CAC44190.1"
FT                   /translation="MPFTPDELEYYASQNLGRLATVAPDGQPQANPVSFRVNTETGTID
FT                   IGGHNLTASKKFRNVTKHDQVAFVVDDLISTQPWNVRGIEVRGRAEALTDAQPPHPYFG
FT                   TAMIRIHPKRIITWGLGGDAAQRGRDV"
     atgcctttca ctcctgacga gctcgagtac tacgcctccc agaacctcgg ccggctggcc        60
     accgtggcgc ccgacggcca gccccaggcc aacccggtct cgttccgcgt caacaccgag       120
     accggcacga tcgacatcgg cgggcacaac ctgaccgcca gcaagaagtt ccgcaacgtc       180
     accaagcacg accaggtcgc cttcgtcgtc gacgacctga tctccacgca gccgtggaac       240
     gtacgcggta tcgaagtgcg cggccgggcc gaggcgctga ccgacgcgca gccgccgcac       300
     ccctacttcg gtaccgcgat gatccgtatc caccccaagc gcatcatcac ctggggcctc       360
     ggcggcgacg ccgcccagcg cggccgcgac gtctga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page