(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5078

AL939122.SCO5078     Location/Qualifiers
FT   CDS_pept        149987..150832
FT                   /transl_table=11
FT                   /gene="SCO5078"
FT                   /gene_synonym="actVA3"
FT                   /gene_synonym="SCBAC28G1.04"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC28G1.04, actVA3, hypothetical protein, len: 281
FT                   aa; identical to previously sequenced TR:Q53905
FT                   (EMBL:X58833) Streptomyces coelicolor 6 ActVA region genes
FT                   of the actinorhodin biosynthetic gene cluster, ActVA3, 281
FT                   aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IZ2"
FT                   /protein_id="CAC44191.1"
FT                   /translation="MSTEIFHEEFAGGLVTEGPGAPWRLRPVDGLEAGDGLVRGGPDGL
FT                   VVVPSAAHPGTRRPAFTEPKPGPDGTPLHLRWGAFTTGGTTGGTAGARAAFTAVPGERL
FT                   SVRAEMGLRGFGLRSHPYDDVTEPDADARLGAGGLISVDLESGIIFDFFLTHSRLYAVY
FT                   ERLALRPDAEFAAFTYCVPVADRTPGTLHRLEVGYDVAAGTAHWTADGQEVLSVDRIGF
FT                   RALDARWLRRDNGGREEAVRPRGLSFGLGLFLERHFGQGVRLSVRRLSVLTSPAGSRDS
FT                   "
     atgagtacag agatcttcca tgaggagttc gccggggggc tggtgaccga ggggccgggc        60
     gcgccgtggc ggcttcgccc ggtcgacggt ctcgaggcgg gagacgggct ggtccgcggg       120
     ggaccggacg gcctggtggt cgtgccgagc gccgcccacc cggggacccg gcggccggcg       180
     ttcaccgagc ccaagcccgg gccggacggc accccgctgc atctgcggtg gggtgccttc       240
     accaccggcg gcaccaccgg cggcaccgcc ggcgcgcggg cggcgttcac cgccgtgccc       300
     ggcgaacggc tctcggtcag ggccgagatg gggctgcgcg gcttcggtct gcgctcccat       360
     ccgtacgacg acgtgaccga acccgacgcg gacgcccggc tcggcgcggg cggtctgatc       420
     tcggtcgatc tcgagtccgg gatcatcttc gacttcttcc tcacacacag ccggctctac       480
     gcggtctacg agcggctcgc gctgcggccg gacgccgagt tcgcggcctt cacctactgc       540
     gtcccggtcg cggaccgcac ccccggcacg ctccaccggc tcgaggtcgg atacgacgtc       600
     gcggccggca ccgcccactg gacggccgac gggcaggagg tcctgtccgt ggaccggatc       660
     ggcttccgcg cactggacgc gcgctggctc cggcgggaca acggcggccg cgaggaggcc       720
     gtacggccgc gcggactcag cttcggcctc gggctcttcc tggagcgcca cttcggccag       780
     ggggtgcggc tgtcggtgcg aaggctgtcg gtgctcacct cgcccgccgg ctcccgcgac       840
     tcgtga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page