(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5084

AL939122.SCO5084     Location/Qualifiers
FT   CDS_pept        155809..157944
FT                   /transl_table=11
FT                   /gene="SCO5084"
FT                   /gene_synonym="actII-3"
FT                   /gene_synonym="SCBAC28G1.10"
FT                   /product="putative membrane protein"
FT                   /note="SCBAC28G1.10, actII-3, putative membrane protein,
FT                   len: 711 aa; identical to previously sequenced
FT                   SW:MMLA_STRCO (EMBL:M64683) Streptomyces coelicolor
FT                   putative membrane protein ActII-3, 711 aa. Contains
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q53902"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q53902"
FT                   /protein_id="CAC44197.1"
FT                   /translation="MTRTLLSWPGGRRLKWLVLAAWIGLLIVLQPLAGKLGDVESNDAA
FT                   AWLPGNAESTEVLELSEKFQPADTSPTVIVYDRPSGITAADEAKARADATHFADGTGVV
FT                   GEPYGPVRSDDGKALRTVVNVHLGKDGWEGLNAAAKDMRAIARPSAPDGLGVHVTGPTG
FT                   YAADSAESFSSADFKLTLVTLLIVVTILVVTYRSPLLWLLPMISAGMSLVISQAIVYLL
FT                   AKNAGLTVNAQTAMILTVLVLGAATDYALLLVARYREELRRHEDRHEAMAVALRRAGPA
FT                   IVASAATVAVSMLVLLLAALNSTKGLGPVCAVGVLVGLLSMMTLLPALLVIFGRWVFWP
FT                   ARPKHGTEPDVTRGLWSRIARLVSGRPRAVWVTTSLLLGAVATLAVTLNADGLQQKDGF
FT                   KTKPESVVGEEILTRHFPAGSGEPMVVIAKGASADQVHAALETVPGVIEVAPPQVKDGL
FT                   AYVEATLGAGADSPAAMRSVTAARETLARLDGAQARVGGSSAVVHDMREASSRDRGLII
FT                   PVILAVVFCILALLLRALVAPLLLIASVVLSFFTALGLAALFFNHVFDFAGADSAFPLW
FT                   VFVFLVALGVDYNIFLVTRIKEESDRLGTRQGALKGLTSTGGVITAAGLVLAGTFAALA
FT                   TLPLVFIAELGFTVAVGVLLDTMIVRSVLVTALTLDVGRWMWWPHPLARREDPSEDPAV
FT                   SGMPDSIDSEASTTASR"
     atgacacgca cactgctgtc ctggcccggc ggacgccggc tcaagtggct ggtgctcgcg        60
     gcctggatcg gtctgctgat cgtgctccag ccgctggcag ggaagctcgg cgacgtcgag       120
     tccaacgacg ccgccgcctg gctccccggc aatgcggagt cgaccgaagt gctcgagctg       180
     tccgagaagt tccagccggc cgacaccagc ccgaccgtga tcgtctacga ccgcccgtcc       240
     gggatcacgg ccgccgacga ggcgaaggcg cgggccgacg ccacgcactt cgcggacggc       300
     accggtgtgg tgggcgagcc ctacggcccg gtgcgctcgg acgacggcaa ggccctgcgc       360
     accgtcgtca acgtccacct cggcaaggac ggctgggagg ggctcaacgc ggccgcgaag       420
     gacatgcggg cgatcgcccg gccgagcgcc ccggacggtc tcggcgtcca cgtcacgggt       480
     ccgaccggtt acgccgccga ttccgcagag tccttcagca gcgccgactt caagctcacc       540
     ctggtcaccc tcctcatcgt cgtgacgatc ctcgtcgtca cctatcgcag tcccttgctc       600
     tggctgctgc cgatgatctc cgcgggcatg tccctggtca tctcgcaggc catcgtctac       660
     ctgctggcca agaacgcggg actcacggtc aacgcccaga cggcgatgat cctcacggtc       720
     ctggtgctcg gcgcggccac cgactacgcg ctgttgctcg tcgcccgcta ccgcgaggag       780
     ctgcggcggc acgaggaccg gcacgaggcc atggccgtgg cgctgcgccg ggccggtccc       840
     gccatcgtgg ccagcgccgc caccgtcgcc gtcagcatgc tcgtcctgct gctggccgct       900
     ctgaactcca ccaagggtct cggcccggtc tgcgccgtcg gcgtgctggt cggcctgctg       960
     tcgatgatga cgttgctgcc cgccctgctg gtgatcttcg gacgctgggt cttctggccg      1020
     gcccggccga agcacggtac ggagcccgac gtcacccggg gtctgtggtc gcggatcgcc      1080
     cggctggtgt ccggccgtcc gcgtgccgtc tgggtcacca ccagcctgct gctgggggcg      1140
     gtggccacgc tggccgtcac cctgaacgcc gacggcctcc agcagaagga cggtttcaag      1200
     accaagccgg agtcggtggt gggcgaggag atcctgaccc ggcacttccc ggccggctcc      1260
     ggtgaaccca tggtcgtcat cgccaagggc gcctcggcgg accaggtgca cgcagctctg      1320
     gagaccgtgc ccggcgtcat cgaggtcgca ccaccacagg tgaaggacgg cctcgcctat      1380
     gtcgaggcga cgctcggcgc cggggcggac tcgccggcgg ccatgcgttc ggtcaccgcg      1440
     gcccgcgaga cactcgcccg gctggacggt gcgcaggcac gggtgggcgg cagcagcgcc      1500
     gtcgtgcacg acatgcggga ggcgtccagc cgcgaccgcg gtctgatcat tccggtgatc      1560
     ctcgccgtgg tgttctgcat cctcgcgctg ctgctgcgag cactggtggc gccgctgctg      1620
     ctgatcgcga gcgtggtgct gtccttcttc accgcgctcg gcctcgccgc cctcttcttc      1680
     aaccacgtct tcgacttcgc gggagccgat tcggccttcc ccctgtgggt cttcgtcttc      1740
     ctggtcgccc tgggcgtcga ctacaacatc ttcctcgtca cccggatcaa ggaggagagc      1800
     gaccggctcg gcacccggca gggcgcgctc aagggcctca cctcgaccgg tggcgtgatc      1860
     accgcggccg ggctggtgct ggccgggacc ttcgccgcgc tggccacgct gccgctggtc      1920
     ttcatcgccg agctcggatt cacggtcgcg gtgggcgtcc tgctcgacac catgatcgtg      1980
     cgatcggtcc tggtcaccgc gctcactctc gatgtcggcc ggtggatgtg gtggccgcac      2040
     ccgctcgccc ggcgcgagga cccttccgag gacccagccg tatcaggaat gccagattct      2100
     attgattcgg aagcctcgac cactgcctct cggtaa                                2136
//

If you have problems or comments...

PBIL Back to PBIL home page