(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5085

AL939122.SCO5085     Location/Qualifiers
FT   CDS_pept        158094..158861
FT                   /transl_table=11
FT                   /gene="SCO5085"
FT                   /gene_synonym="actII-4"
FT                   /gene_synonym="SCBAC28G1.11"
FT                   /product="actinorhodin cluster activator protein"
FT                   /note="SCBAC28G1.11, actII-4, actinorhodin cluster
FT                   activator protein, len: 255 aa; identical to previously
FT                   sequenced SW:AC24_STRCO (EMBL:M64683) Streptomyces
FT                   coelicolor actinorhodin operon activator protein ActII-4,
FT                   255 aa. Contains a leucine TTA codon, possible target for
FT                   bldA regulation"
FT                   /db_xref="GOA:P46106"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46106"
FT                   /protein_id="CAC44198.1"
FT                   /translation="MRFNLLGRVHVITDAGCVIPLKSSKATQLLVLLLLRRHEVVGSGV
FT                   LIEELWADHPPRSAMTTLQTYVYHTRRLLGEHRVTSDDRELVLTQPPGYFALIDEDELD
FT                   VAVAERLIRTGGRLLEENRLEEALASLDAGLDLWRGPALSTVPCGRVLESNIAHLEELR
FT                   LFGMQLRIDANWRLGRIGPMIPELRSLVISHPLNETLHAKLMGALCQMGRRAEALESYR
FT                   NLRRILSDELGVDPTPEIQRMHMEILNGEKVLV"
     atgagattca acttattggg acgtgtccat gtaatcaccg atgcgggatg tgtaattccg        60
     cttaaatcct cgaaggcgac ccagctcctg gtgctgctgc tcctcaggcg gcacgaggtg       120
     gtgggatcgg gggtgctcat cgaggagttg tgggcggacc acccgccccg cagcgccatg       180
     acgacgctgc agacgtacgt gtaccacacc cgccggctgc tgggggagca ccgggtgacg       240
     agcgacgacc gggaattggt cctgacccag ccgcccggct acttcgccct gatcgacgag       300
     gacgaactcg acgtcgcggt cgccgagcgt ctgatccgca ccggcggccg gctgctcgag       360
     gagaaccggc tcgaggaggc gctcgcctcg ttggacgcgg gactggatct ctggcgaggc       420
     ccggcgctgt ccaccgtacc gtgcggccgg gtgctcgaaa gcaatatcgc gcacctggaa       480
     gagctgcggc tttttggaat gcagctccgt atcgacgcga attggcggct gggcagaata       540
     gggccgatga ttccggaact ccggtccctg gtaatttcgc atccgctgaa cgagaccctg       600
     cacgccaaac tgatgggcgc gctctgtcag atgggcaggc gcgccgaggc gctggaatcg       660
     tatcggaatc tccggcggat actgtccgac gaactggggg tggatccgac gccggaaatc       720
     cagcgtatgc acatggaaat tctcaacggt gagaaggtgc tcgtgtag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page