(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5087

AL939122.SCO5087     Location/Qualifiers
FT   CDS_pept        159801..161204
FT                   /transl_table=11
FT                   /gene="SCO5087"
FT                   /gene_synonym="actIORF1"
FT                   /gene_synonym="SCBAC28G1.13"
FT                   /product="actinorhodin polyketide beta-ketoacyl synthase
FT                   alpha subunit"
FT                   /note="SCBAC28G1.13, actIORF1, actinorhodin polyketide
FT                   beta-ketoacyl synthase alpha subunit, len: 467 aa;
FT                   identical to C-terminal region of SW:KASA_STRCO
FT                   (EMBL:X63449) Streptomyces coelicolor actinorhodin
FT                   polyketide putative beta-ketoacyl synthase 1 ActI ORF1, 424
FT                   aa. Previously sequenced start codon at residue 44 of this
FT                   sequence. Also similar to TR:CAB45606 (EMBL:AL079356)
FT                   Streptomyces coelicolor polyketide beta-ketoacyl synthase
FT                   alpha (WhiE locus) SC6G9.15, 424 aa; fasta scores: opt:
FT                   1706 Z-score: 1660.2 bits: 316.4 E(): 9.5e-87; 61.871%
FT                   identity in 417 aa overlap. Contains Pfam matches to
FT                   entries PF00109 ketoacyl-synt, Beta-ketoacyl synthase,
FT                   N-terminal domain and PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain and match to
FT                   Prosite entry PS00606 Beta-ketoacyl synthases active site"
FT                   /db_xref="GOA:Q02059"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="PDB:1QXG"
FT                   /db_xref="PDB:1TQY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02059"
FT                   /protein_id="CAC44200.1"
FT                   /translation="MPLDAAPVDPASRGPVSAFEPPSSHGADDDDDHRTNASKELFGLK
FT                   RRVVITGVGVRAPGGNGTRQFWELLTSGRTATRRISFFDPSPYRSQVAAEADFDPVAEG
FT                   FGPRELDRMDRASQFAVACAREAFAASGLDPDTLDPARVGVSLGSAVAAATSLEREYLL
FT                   LSDSGRDWEVDAAWLSRHMFDYLVPSVMPAEVAWAVGAEGPVTMVSTGCTSGLDSVGNA
FT                   VRAIEEGSADVMFAGAADTPITPIVVACFDAIRATTARNDDPEHASRPFDGTRDGFVLA
FT                   EGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGREMAETIRVALDESR
FT                   TDATDIDYINAHGSGTRQNDRHETAAYKRALGEHARRTPVSSIKSMVGHSLGAIGSLEI
FT                   AACVLALEHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLR
FT                   DAETAGAAA"
     gtgccgctgg acgcggcgcc ggtggatccg gcatcgaggg gtcccgtatc ggccttcgag        60
     cctccttcga gccacggggc cgacgatgac gacgaccacc ggacgaacgc atcgaaggag       120
     ctgttcggat tgaagcgcag agtcgtcatc acgggcgtcg gcgtccgcgc ccccggcggg       180
     aacggcaccc ggcagttctg ggaactgctc acctcggggc ggacggcgac gcgccggatc       240
     tcgttcttcg acccctcgcc ctaccgttca caggtcgcgg cggaggccga cttcgacccg       300
     gtcgccgagg gcttcggccc gcgggagctc gaccggatgg accgggcctc gcagttcgcc       360
     gtggcctgtg cccgggaggc gttcgccgcc agcgggctcg acccggacac cctcgacccc       420
     gcccgggtcg gggtcagcct cggcagcgcg gtggcagcgg cgaccagcct ggagcgcgag       480
     tatctgctgc tgtcggactc cggccgtgac tgggaggtcg acgcggcctg gctgtcccgg       540
     cacatgttcg actacctggt gcccagcgtc atgccggccg aggtcgcctg ggcggtcggc       600
     gccgagggcc cggtcacgat ggtctccacc ggctgcacct cgggcctgga ctccgtcggc       660
     aacgcggtcc gggcgatcga ggagggcagc gccgacgtga tgttcgcggg agccgccgac       720
     accccgatca ccccgatcgt cgtcgcctgc ttcgacgcga tccgcgccac gacggcgcgc       780
     aacgacgacc cggagcacgc ctcgcggccg ttcgacggta cgcgggacgg cttcgtgctg       840
     gccgaaggag ccgcgatgtt cgtcctggag gactacgaca gcgcgctggc ccgcggagcc       900
     cgcatccacg ccgagatctc ggggtacgcg acgcgctgca acgcgtacca catgacgggc       960
     ctgaaggccg acggccgcga gatggccgag accatccggg tcgccctcga cgagtcccgc      1020
     acggacgcga cggacatcga ctacatcaac gcgcacggct ccggcacccg gcagaacgac      1080
     cgccacgaga cagcggcgta caagcgcgcc ctcggcgaac acgcccggcg cactccggtc      1140
     agctcgatca agtcgatggt cggccactcg ctgggcgcga tcggctcgct ggagatcgcg      1200
     gcctgcgtac tcgccctcga acacggcgtg gtgcccccga ccgccaacct gcgcaccagc      1260
     gaccccgagt gcgatctcga ctacgttccg ctggaggcca gggagcggaa gctgcggtcc      1320
     gtactcaccg tgggcagcgg cttcggcggc ttccagagcg cgatggtgct gcgcgacgcc      1380
     gagaccgcgg gggcggccgc atga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page