(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5088

AL939122.SCO5088     Location/Qualifiers
FT   CDS_pept        161201..162424
FT                   /transl_table=11
FT                   /gene="SCO5088"
FT                   /gene_synonym="actIORF2"
FT                   /gene_synonym="SCBAC28G1.14"
FT                   /product="actinorhodin polyketide beta-ketoacyl synthase
FT                   beta subunit"
FT                   /note="SCBAC28G1.14, actIORF2, actinorhodin polyketide
FT                   beta-ketoacyl synthase beta subunit (also known as chain
FT                   length factor), len: 407 aa; identical to previously
FT                   sequenced SW:KASB_STRCO (EMBL:X63449) Streptomyces
FT                   coelicolor actinorhodin polyketide putative beta-ketoacyl
FT                   synthase 2 ActI ORF2, 407 aa. Contains Pfam matches to
FT                   entries PF00109 ketoacyl-synt, Beta-ketoacyl synthase,
FT                   N-terminal domain and PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain"
FT                   /db_xref="GOA:Q02062"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="PDB:1QXG"
FT                   /db_xref="PDB:1TQY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02062"
FT                   /protein_id="CAC44201.1"
FT                   /translation="MSVLITGVGVVAPNGLGLAPYWSAVLDGRHGLGPVTRFDVSRYPA
FT                   TLAGQIDDFHAPDHIPGRLLPQTDPSTRLALTAADWALQDAKADPESLTDYDMGVVTAN
FT                   ACGGFDFTHREFRKLWSEGPKSVSVYESFAWFYAVNTGQISIRHGMRGPSSALVAEQAG
FT                   GLDALGHARRTIRRGTPLVVSGGVDSALDPWGWVSQIASGRISTATDPDRAYLPFDERA
FT                   AGYVPGEGGAILVLEDSAAAEARGRHDAYGELAGCASTFDPAPGSGRPAGLERAIRLAL
FT                   NDAGTGPEDVDVVFADGAGVPELDAAEARAIGRVFGREGVPVTVPKTTTGRLYSGGGPL
FT                   DVVTALMSLREGVIAPTAGVTSVPREYGIDLVLGEPRSTAPRTALVLARGRWGFNSAAV
FT                   LRRFAPTP"
     atgagcgtcc tcatcaccgg agtcggcgtc gtcgcaccca acggcctcgg cctggcgccg        60
     tactggtcgg cggtgctgga cggccgccac ggcctcggcc cggtcacccg cttcgacgtg       120
     agccggtacc cggcgaccct cgccggccag atcgacgact tccacgcgcc ggaccacatc       180
     ccgggccggt tgctgccgca gacggacccc tccacacggc tcgcgctgac cgccgcggac       240
     tgggccctcc aggacgcgaa ggcggacccg gagtcgctga ccgactacga catgggcgtg       300
     gtgaccgcca acgcctgcgg tgggttcgac ttcacccacc gggagttccg caagctgtgg       360
     tccgagggcc ccaagtcggt cagcgtgtac gagtccttcg cctggttcta cgcggtgaac       420
     accggccaga tctccatccg gcacggtatg cgcggtccga gcagtgccct ggtcgccgag       480
     caggccgggg gcctggacgc cctgggccac gcccgccgta cgatccgccg cggcacgccg       540
     ctggtggtct ccggcggggt ggactcggca ctcgacccgt ggggctgggt ctcgcagatc       600
     gccagtggcc ggatcagcac ggccaccgat ccggaccggg cgtatctgcc cttcgacgag       660
     cgggcggccg gctacgttcc gggcgagggc ggggccatcc tcgtcctgga ggacagcgcc       720
     gcggccgagg cccgcggccg gcacgacgcg tacggcgaac tcgccggctg cgcctccacc       780
     ttcgaccccg cccccggatc cggacggccc gcgggcctgg aacgcgcgat ccggctggcg       840
     ctgaacgacg ccgggaccgg tcccgaggac gtcgacgtcg tgttcgccga cggcgcgggc       900
     gtgcccgagc tggacgccgc cgaggcccgg gcgatcggcc gggtgttcgg ccgcgaaggg       960
     gtgcccgtca ccgtccccaa gacgacgacg ggccgcctct actccggcgg cggcccgctc      1020
     gacgtggtca ccgccctgat gtccctgcgc gaaggggtga tcgcgccgac cgcgggcgtg      1080
     acgtccgtac cccgggagta cggcatcgac ctggtgctcg gcgaaccccg cagcacggcc      1140
     ccgcgcaccg cactggtcct ggccaggggc cgctggggct tcaactcggc ggcggtcctg      1200
     cgccgtttcg caccgacccc gtaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page