(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5093

AL939122.SCO5093     Location/Qualifiers
FT   CDS_pept        complement(165110..165607)
FT                   /transl_table=11
FT                   /gene="SCO5093"
FT                   /gene_synonym="ORF7"
FT                   /gene_synonym="SCBAC28G1.19c"
FT                   /product="putative mini-circle protein"
FT                   /note="SCBAC28G1.19c, ORF7, putative mini-circle protein,
FT                   len: 165 aa; identical to previously sequenced TR:Q9X9V2
FT                   (EMBL:Y18817) Streptomyces coelicolor A3(2) putative
FT                   mini-circle protein ORF7, 165 aa"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9X9V2"
FT                   /protein_id="CAC44206.1"
FT                   /translation="MPTTPRTHRRDTPPPRTGGGEAETLRGFLDYLRTSIAGKVEDAPE
FT                   PQVRTAAVASGTNLLGLLNHLTHVERAVFLGEEVRSWPATFRAASQDGVADVVARYREA
FT                   VERANRVLDACTDLGAPLPRPRPGRPAPSVRWALTHMVEETGRHAGHADILRELIDGAT
FT                   GR"
     atgcccacca ccccccgcac ccaccgccgg gacaccccgc cgccccgaac cggcggcggt        60
     gaggccgaga ccctgcgcgg gttcctcgac tacctgcgga cctcgatcgc cggcaaggtc       120
     gaggacgccc ccgaaccgca ggtccgcacg gcggcggtgg cgtccggcac caacctgctc       180
     gggctgctca accacctgac ccacgtcgag cgcgcggtct tcctcgggga ggaggtgcga       240
     agctggccgg cgacgttccg ggccgcgtcc caggacggcg tcgccgacgt cgtcgcccgc       300
     taccgggagg ccgtcgaacg ggcgaaccgc gtgctcgacg cctgcaccga cctcggcgca       360
     ccgctccccc ggccgcgacc gggccgcccc gcgcccagtg tccgctgggc cctcacccac       420
     atggtggagg agaccggccg ccacgccggc cacgccgaca tcctccgcga gctgatcgac       480
     ggtgccacgg gccgctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page