(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5098

AL939122.SCO5098     Location/Qualifiers
FT   CDS_pept        169158..169622
FT                   /transl_table=11
FT                   /gene="SCO5098"
FT                   /gene_synonym="ORF12"
FT                   /gene_synonym="SCBAC28G1.24"
FT                   /product="putative integral membrane protein"
FT                   /note="SCBAC28G1.24, possible integral membrane protein,
FT                   len: 154 aa; identical in its C-terminal domain to
FT                   TR:Q9X9U7 (EMBL:Y18817) Streptomyces coelicolor A3(2)
FT                   hypothetical 11.9 kDa protein ORF11, 113 aa. Contains
FT                   possible hydrophobic membrane spanning regions and 10x
FT                   degenerate repeat at N-terminal region: M(P/V). Alternative
FT                   start codon in previously sequence EMBL entrance after the
FT                   repeat region at residue 42"
FT                   /db_xref="GOA:Q93IY7"
FT                   /db_xref="InterPro:IPR021214"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY7"
FT                   /protein_id="CAC44211.1"
FT                   /translation="MPDCTRPCPIVPVPMPMPMPMPMPMPMPVPVPASVPNQESAVLSS
FT                   LKAVNLLVMFLLELAVYTAVVLWGVAVGGTWPVEVALGVGAPVVMMAAWALFGSPRARR
FT                   PARGAGRFVLEVLWFGAGAAALAASGRPWWAAALAGVCLVNAVLRRLWKQ"
     gtgcccgact gcacccgacc gtgcccgatc gtgcccgtgc ccatgcccat gcccatgccc        60
     atgcccatgc ccatgcccat gcccgtgccc gtgcccgcgt ccgtgccgaa ccaggagtcc       120
     gccgtgctct cgtccctgaa ggccgtcaac ctgctggtga tgttcctgct ggaactcgcg       180
     gtgtacacgg cggtcgtgct ctggggggtc gccgtcggcg gcacatggcc ggtcgaggtg       240
     gccctggggg tgggcgcgcc ggtcgtgatg atggcggcgt gggcgctgtt cgggtcgccg       300
     cgcgcccgcc gtccggcgcg cggggccggg cggttcgtcc tggaggtgct ctggttcggt       360
     gccggtgcgg ccgccctggc cgcctccggg agaccgtggt gggcggccgc cctcgccggg       420
     gtctgcctgg tcaacgcggt gctcagacgg ttgtggaagc agtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page