(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5099

AL939122.SCO5099     Location/Qualifiers
FT   CDS_pept        169732..170862
FT                   /transl_table=11
FT                   /gene="SCO5099"
FT                   /gene_synonym="SCBAC28G1.25"
FT                   /product="putative membrane protein"
FT                   /note="SCBAC28G1.25, possible membrane protein, len: 376
FT                   aa. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q93IY6"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY6"
FT                   /protein_id="CAC44212.1"
FT                   /translation="MSIPPPPGPQGQYPQGPYAPQWGHPLAPYPRPAPVSGLAVAAFVL
FT                   GVLCFLPAVGLVLGLVALARIRRRGERGKGFAVAGCVLSSVGLALWTLTLSTGAAGDFW
FT                   DGFRDAARGGGTAYSLEKGQCFTTPSGSLQGVTYDVDEVPCAREHDGEVFASFDLPDGS
FT                   YPGDGEITRAADDRCYALQDAYAMDRWALPTDVDVYYLTPTAASWRTGDREITCLFGNT
FT                   DERGTLTGSLRNDGARFDADQHTYLLAEGYLNRAMDEVPAAEAVEDDLAGYRTWAGQVS
FT                   EALRGEVAMLDGHEWPAGAERPVAALTDDLRSAQEEWGLAAKAADLDAYYEHYGKGYDL
FT                   VVADSTVTARKALGLATTPPDYEGGEGGGDDPGVEV"
     gtgtcgatac cgccaccgcc ggggccccaa gggcagtacc cccagggtcc gtacgctccg        60
     cagtgggggc accccctcgc gccgtacccc cggccggctc ccgtgagcgg gctcgccgtc       120
     gccgcgttcg tcctcggcgt cctgtgcttc ctgccggcgg tcggactggt cctcgggctg       180
     gtcgcgctgg cccggatccg caggcggggc gaacgcggca aggggttcgc ggtggccggc       240
     tgcgtgctgt cctccgtggg gctggccctg tggacgctga cgctgtcgac gggcgccgcg       300
     ggcgacttct gggacggctt ccgggacgcc gcgcgcggcg ggggcaccgc ctactccctg       360
     gagaagggcc agtgcttcac cacccccagc ggctccctcc aaggggtgac gtacgacgtc       420
     gacgaggtgc cctgcgcgcg ggagcacgac ggcgaggtct tcgcctcctt cgacctgccg       480
     gacggttcct acccgggcga cggggagatc acgcgggccg ccgacgaccg gtgctacgcc       540
     ctccaggacg cctacgcgat ggaccggtgg gcactgccga ccgacgtcga cgtgtactac       600
     ctgaccccga ccgccgcgag ctggcggacc ggcgaccgcg agatcacctg cctgttcggc       660
     aacacggacg agcggggcac gctgaccggc tcgctgcgca acgacggcgc gcggttcgac       720
     gcggaccagc acacctacct gctcgcggag ggctacctga accgggccat ggacgaggtg       780
     cccgcggcgg aggcggtcga ggacgacctc gcgggctacc ggacctgggc cgggcaggtc       840
     tcggaggcgc tcaggggcga ggtcgcgatg ctggacgggc acgagtggcc cgccggcgcc       900
     gagcgcccgg tcgccgcgct gaccgacgac ctgcggtcgg cgcaggagga gtggggcctg       960
     gcggctaagg ccgccgacct cgacgcgtac tacgagcact acggcaaggg ctacgacctc      1020
     gtcgtcgccg acagcacggt caccgcacgc aaggctctgg gcctggccac cacgccgccg      1080
     gactacgagg gcggcgaggg cgggggagac gaccccggcg tggaggtgtg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page